Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1220699..1221616 | Replicon | chromosome |
Accession | NZ_CP126226 | ||
Organism | Bacillus velezensis strain B31 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | I2HQ15 |
Locus tag | QNM98_RS06490 | Protein ID | WP_007407256.1 |
Coordinates | 1220870..1221616 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | QNM98_RS06485 | Protein ID | WP_003154807.1 |
Coordinates | 1220699..1220869 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM98_RS06450 (QNM98_06450) | 1215922..1217553 | + | 1632 | WP_015417294.1 | pyocin knob domain-containing protein | - |
QNM98_RS06455 (QNM98_06455) | 1217566..1217937 | + | 372 | WP_015417295.1 | XkdW family protein | - |
QNM98_RS06460 (QNM98_06460) | 1217942..1218139 | + | 198 | WP_012117366.1 | XkdX family protein | - |
QNM98_RS06465 (QNM98_06465) | 1218196..1218957 | + | 762 | WP_031378811.1 | hypothetical protein | - |
QNM98_RS06470 (QNM98_06470) | 1219009..1219272 | + | 264 | WP_031378810.1 | hemolysin XhlA family protein | - |
QNM98_RS06475 (QNM98_06475) | 1219286..1219549 | + | 264 | WP_003154813.1 | phage holin | - |
QNM98_RS06480 (QNM98_06480) | 1219563..1220441 | + | 879 | WP_007407257.1 | N-acetylmuramoyl-L-alanine amidase | - |
QNM98_RS06485 (QNM98_06485) | 1220699..1220869 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QNM98_RS06490 (QNM98_06490) | 1220870..1221616 | - | 747 | WP_007407256.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QNM98_RS06495 (QNM98_06495) | 1221721..1222719 | - | 999 | WP_003154805.1 | inorganic phosphate transporter | - |
QNM98_RS06500 (QNM98_06500) | 1222732..1223349 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
QNM98_RS06505 (QNM98_06505) | 1223635..1224951 | - | 1317 | WP_007610842.1 | amino acid permease | - |
QNM98_RS06510 (QNM98_06510) | 1225274..1226224 | + | 951 | WP_043867021.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29077.57 Da Isoelectric Point: 4.7755
>T282733 WP_007407256.1 NZ_CP126226:c1221616-1220870 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|