Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 489236..489873 | Replicon | chromosome |
Accession | NZ_CP126226 | ||
Organism | Bacillus velezensis strain B31 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QNM98_RS02495 | Protein ID | WP_003156187.1 |
Coordinates | 489523..489873 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | I2HMS5 |
Locus tag | QNM98_RS02490 | Protein ID | WP_003156188.1 |
Coordinates | 489236..489517 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM98_RS02470 (QNM98_02470) | 485601..486200 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
QNM98_RS02475 (QNM98_02475) | 486293..486658 | + | 366 | WP_007410229.1 | holo-ACP synthase | - |
QNM98_RS02480 (QNM98_02480) | 486823..487830 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
QNM98_RS02485 (QNM98_02485) | 487947..489116 | + | 1170 | WP_012116870.1 | alanine racemase | - |
QNM98_RS02490 (QNM98_02490) | 489236..489517 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QNM98_RS02495 (QNM98_02495) | 489523..489873 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNM98_RS02500 (QNM98_02500) | 489991..490812 | + | 822 | WP_015416874.1 | STAS domain-containing protein | - |
QNM98_RS02505 (QNM98_02505) | 490817..491182 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
QNM98_RS02510 (QNM98_02510) | 491185..491586 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
QNM98_RS02515 (QNM98_02515) | 491598..492605 | + | 1008 | WP_015416875.1 | PP2C family protein-serine/threonine phosphatase | - |
QNM98_RS02520 (QNM98_02520) | 492669..492998 | + | 330 | WP_033575044.1 | anti-sigma factor antagonist | - |
QNM98_RS02525 (QNM98_02525) | 492995..493477 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
QNM98_RS02530 (QNM98_02530) | 493443..494231 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
QNM98_RS02535 (QNM98_02535) | 494231..494833 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T282732 WP_003156187.1 NZ_CP126226:489523-489873 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|