Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3721910..3722527 | Replicon | chromosome |
| Accession | NZ_CP126169 | ||
| Organism | Rahnella bonaserana strain L46 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H8NYI7 |
| Locus tag | QNM34_RS17150 | Protein ID | WP_013576617.1 |
| Coordinates | 3722324..3722527 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | QNM34_RS17145 | Protein ID | WP_104923047.1 |
| Coordinates | 3721910..3722278 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNM34_RS17115 (QNM34_17115) | 3717902..3718156 | + | 255 | WP_217174193.1 | type B 50S ribosomal protein L31 | - |
| QNM34_RS17120 (QNM34_17120) | 3718177..3718317 | + | 141 | WP_095924976.1 | type B 50S ribosomal protein L36 | - |
| QNM34_RS17125 (QNM34_17125) | 3718445..3719323 | - | 879 | WP_217174194.1 | metal ABC transporter substrate-binding protein | - |
| QNM34_RS17130 (QNM34_17130) | 3719367..3720224 | - | 858 | WP_112287526.1 | metal ABC transporter permease | - |
| QNM34_RS17135 (QNM34_17135) | 3720221..3720982 | - | 762 | WP_217174195.1 | ABC transporter ATP-binding protein | - |
| QNM34_RS17140 (QNM34_17140) | 3721334..3721687 | + | 354 | WP_284003171.1 | hypothetical protein | - |
| QNM34_RS17145 (QNM34_17145) | 3721910..3722278 | + | 369 | WP_104923047.1 | Hha toxicity modulator TomB | Antitoxin |
| QNM34_RS17150 (QNM34_17150) | 3722324..3722527 | + | 204 | WP_013576617.1 | HHA domain-containing protein | Toxin |
| QNM34_RS17155 (QNM34_17155) | 3722610..3723560 | - | 951 | WP_284006264.1 | LysR family transcriptional regulator | - |
| QNM34_RS17160 (QNM34_17160) | 3723697..3725484 | + | 1788 | WP_284003180.1 | adenine deaminase C-terminal domain-containing protein | - |
| QNM34_RS17165 (QNM34_17165) | 3725560..3726909 | + | 1350 | WP_217174199.1 | NCS2 family permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8114.45 Da Isoelectric Point: 6.9764
>T282731 WP_013576617.1 NZ_CP126169:3722324-3722527 [Rahnella bonaserana]
MNKIDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPVSVWKFVR
MNKIDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPVSVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14378.15 Da Isoelectric Point: 4.7281
>AT282731 WP_104923047.1 NZ_CP126169:3721910-3722278 [Rahnella bonaserana]
MDEYSPKRHDIAQLRYLNEMLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFVMSFKIKYPDDTHLSDLVEEYL
DDTYTLFSNYGINDSDLRQWQKTKKRLFRMFSGDYICTLMKT
MDEYSPKRHDIAQLRYLNEMLYDEGIATLGDSHHGWVNDPTSAVNLQLNELIEHIASFVMSFKIKYPDDTHLSDLVEEYL
DDTYTLFSNYGINDSDLRQWQKTKKRLFRMFSGDYICTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|