Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 860178..860877 | Replicon | chromosome |
Accession | NZ_CP126169 | ||
Organism | Rahnella bonaserana strain L46 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | QNM34_RS03920 | Protein ID | WP_217171705.1 |
Coordinates | 860425..860877 (+) | Length | 151 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | QNM34_RS03915 | Protein ID | WP_217171728.1 |
Coordinates | 860178..860444 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM34_RS03885 (QNM34_03885) | 855385..855690 | - | 306 | WP_112289780.1 | YqjD family protein | - |
QNM34_RS03890 (QNM34_03890) | 855964..857160 | + | 1197 | WP_217171702.1 | MFS transporter | - |
QNM34_RS03895 (QNM34_03895) | 857287..857622 | + | 336 | WP_217149125.1 | DUF2002 family protein | - |
QNM34_RS03900 (QNM34_03900) | 857677..858117 | - | 441 | WP_120508960.1 | DUF1198 domain-containing protein | - |
QNM34_RS03905 (QNM34_03905) | 858318..858848 | + | 531 | WP_217171703.1 | class IV adenylate cyclase | - |
QNM34_RS03910 (QNM34_03910) | 858907..859899 | - | 993 | WP_284005084.1 | tRNA-modifying protein YgfZ | - |
QNM34_RS03915 (QNM34_03915) | 860178..860444 | + | 267 | WP_217171728.1 | FAD assembly factor SdhE | Antitoxin |
QNM34_RS03920 (QNM34_03920) | 860425..860877 | + | 453 | WP_217171705.1 | protein YgfX | Toxin |
QNM34_RS03925 (QNM34_03925) | 860922..861440 | - | 519 | WP_217171706.1 | flavodoxin FldB | - |
QNM34_RS03930 (QNM34_03930) | 861551..862510 | + | 960 | WP_217171707.1 | site-specific tyrosine recombinase XerD | - |
QNM34_RS03935 (QNM34_03935) | 862536..863255 | + | 720 | WP_284006213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QNM34_RS03940 (QNM34_03940) | 863262..864995 | + | 1734 | WP_284005085.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 151 a.a. Molecular weight: 17612.73 Da Isoelectric Point: 10.9957
>T282721 WP_217171705.1 NZ_CP126169:860425-860877 [Rahnella bonaserana]
VALWRCDLRVSWRSQLFSLGCYGAVMLLILLAPWPAGYWPVWMTLLLLVLFECIRSQRRITARTGEIVLTDDYRLLWRGH
EWQIKHPVWMISHGALLSLRREKLKGGLAQAMRSSRQRLWLASDSMSQEEWRHLRQILLNTHPRSPAEPG
VALWRCDLRVSWRSQLFSLGCYGAVMLLILLAPWPAGYWPVWMTLLLLVLFECIRSQRRITARTGEIVLTDDYRLLWRGH
EWQIKHPVWMISHGALLSLRREKLKGGLAQAMRSSRQRLWLASDSMSQEEWRHLRQILLNTHPRSPAEPG
Download Length: 453 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|