Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 1932510..1933096 Replicon chromosome
Accession NZ_CP126166
Organism Salmonella enterica subsp. enterica strain CRSE-01

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag NED09_RS09195 Protein ID WP_000174964.1
Coordinates 1932728..1933096 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag NED09_RS09190 Protein ID WP_001522145.1
Coordinates 1932510..1932731 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NED09_RS09165 (1927531) 1927531..1928640 + 1110 WP_000822978.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NED09_RS09170 (1928700) 1928700..1929626 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NED09_RS09175 (1929623) 1929623..1930900 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
NED09_RS09180 (1930897) 1930897..1931664 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NED09_RS09185 (1931666) 1931666..1932379 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NED09_RS09190 (1932510) 1932510..1932731 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NED09_RS09195 (1932728) 1932728..1933096 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NED09_RS09200 (1933355) 1933355..1934671 + 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NED09_RS09205 (1934776) 1934776..1935663 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NED09_RS09210 (1935660) 1935660..1936505 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NED09_RS09215 (1936507) 1936507..1937577 + 1071 WP_000907840.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1929623..1938314 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T282710 WP_000174964.1 NZ_CP126166:1932728-1933096 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT282710 WP_001522145.1 NZ_CP126166:1932510-1932731 [Salmonella enterica subsp. enterica]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References