Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1822381..1823141 | Replicon | chromosome |
Accession | NZ_CP126166 | ||
Organism | Salmonella enterica subsp. enterica strain CRSE-01 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A1R2W0C7 |
Locus tag | NED09_RS08710 | Protein ID | WP_000533912.1 |
Coordinates | 1822656..1823141 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | M7RHS4 |
Locus tag | NED09_RS08705 | Protein ID | WP_000965886.1 |
Coordinates | 1822381..1822668 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NED09_RS08685 (1817786) | 1817786..1818697 | + | 912 | WP_001168551.1 | glycine--tRNA ligase subunit alpha | - |
NED09_RS08690 (1818707) | 1818707..1820776 | + | 2070 | WP_001291741.1 | glycine--tRNA ligase subunit beta | - |
NED09_RS08695 (1821166) | 1821166..1821564 | + | 399 | Protein_1677 | IS3 family transposase | - |
NED09_RS08700 (1821736) | 1821736..1822203 | + | 468 | WP_000702452.1 | GNAT family N-acetyltransferase | - |
NED09_RS08705 (1822381) | 1822381..1822668 | + | 288 | WP_000965886.1 | DUF1778 domain-containing protein | Antitoxin |
NED09_RS08710 (1822656) | 1822656..1823141 | + | 486 | WP_000533912.1 | GNAT family N-acetyltransferase | Toxin |
NED09_RS08715 (1823512) | 1823512..1824051 | - | 540 | WP_000047147.1 | copper-binding periplasmic metallochaperone CueP | - |
NED09_RS08720 (1824225) | 1824225..1824437 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
NED09_RS08725 (1824725) | 1824725..1825015 | - | 291 | WP_000455790.1 | HTH-type transcriptional regulator | - |
NED09_RS08730 (1825454) | 1825454..1826164 | + | 711 | WP_000190524.1 | DUF3053 domain-containing protein | - |
NED09_RS08735 (1826214) | 1826214..1827188 | - | 975 | WP_000804678.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
NED09_RS08740 (1827407) | 1827407..1828069 | - | 663 | WP_000747548.1 | OmpA family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17731.46 Da Isoelectric Point: 9.8719
>T282709 WP_000533912.1 NZ_CP126166:1822656-1823141 [Salmonella enterica subsp. enterica]
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEVTGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
VGRVTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEVTGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKSSQTQQRTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1R2W0C7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V2JDX2 |