Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1121722..1122503 | Replicon | chromosome |
| Accession | NZ_CP126166 | ||
| Organism | Salmonella enterica subsp. enterica strain CRSE-01 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | B5R980 |
| Locus tag | NED09_RS05495 | Protein ID | WP_000626100.1 |
| Coordinates | 1121722..1122213 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | B5R979 |
| Locus tag | NED09_RS05500 | Protein ID | WP_001110452.1 |
| Coordinates | 1122210..1122503 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NED09_RS05460 (1117182) | 1117182..1117529 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
| NED09_RS05465 (1117505) | 1117505..1119208 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
| NED09_RS05470 (1119245) | 1119245..1119820 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
| NED09_RS05480 (1120091) | 1120091..1120165 | - | 75 | Protein_1063 | helix-turn-helix domain-containing protein | - |
| NED09_RS05485 (1120545) | 1120545..1120622 | + | 78 | Protein_1064 | porin family protein | - |
| NED09_RS05490 (1120722) | 1120722..1121474 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
| NED09_RS05495 (1121722) | 1121722..1122213 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
| NED09_RS05500 (1122210) | 1122210..1122503 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
| NED09_RS05505 (1122820) | 1122820..1123041 | + | 222 | WP_001576552.1 | hypothetical protein | - |
| NED09_RS05510 (1123307) | 1123307..1124182 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
| NED09_RS05515 (1124179) | 1124179..1124466 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
| NED09_RS05520 (1124459) | 1124459..1124767 | - | 309 | WP_072095651.1 | ABC transporter ATP-binding protein | - |
| NED09_RS05525 (1124766) | 1124766..1125014 | + | 249 | Protein_1072 | Ig-like domain-containing protein | - |
| NED09_RS05530 (1125126) | 1125126..1125257 | + | 132 | Protein_1073 | hypothetical protein | - |
| NED09_RS05535 (1125551) | 1125551..1126456 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T282706 WP_000626100.1 NZ_CP126166:c1122213-1121722 [Salmonella enterica subsp. enterica]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656IQ80 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 7AK7 | |
| AlphaFold DB | A0A5I1DGA4 |