Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 973701..974251 | Replicon | chromosome |
Accession | NZ_CP126166 | ||
Organism | Salmonella enterica subsp. enterica strain CRSE-01 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | NED09_RS04715 | Protein ID | WP_001199743.1 |
Coordinates | 973701..974009 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | M7RP97 |
Locus tag | NED09_RS04720 | Protein ID | WP_001118105.1 |
Coordinates | 974012..974251 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NED09_RS04695 (970275) | 970275..971015 | - | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
NED09_RS04700 (971137) | 971137..971667 | - | 531 | WP_000909461.1 | SEF14 fimbria major subunit SefA | - |
NED09_RS04705 (971990) | 971990..973123 | + | 1134 | Protein_913 | IS3 family transposase | - |
NED09_RS04710 (973155) | 973155..973295 | - | 141 | Protein_914 | Arm DNA-binding domain-containing protein | - |
NED09_RS04715 (973701) | 973701..974009 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
NED09_RS04720 (974012) | 974012..974251 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NED09_RS04725 (974360) | 974360..974608 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
NED09_RS04730 (974799) | 974799..975230 | - | 432 | Protein_918 | helix-turn-helix domain-containing protein | - |
NED09_RS04740 (975987) | 975987..977006 | + | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
NED09_RS04745 (977034) | 977034..977564 | - | 531 | WP_000896758.1 | gluconokinase | - |
NED09_RS04750 (977781) | 977781..978812 | + | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 972082..975185 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T282704 WP_001199743.1 NZ_CP126166:c974009-973701 [Salmonella enterica subsp. enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H9SZK8 |