Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 929440..930016 | Replicon | chromosome |
Accession | NZ_CP126166 | ||
Organism | Salmonella enterica subsp. enterica strain CRSE-01 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | M7RG88 |
Locus tag | NED09_RS04505 | Protein ID | WP_001131963.1 |
Coordinates | 929729..930016 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | B5R9R5 |
Locus tag | NED09_RS04500 | Protein ID | WP_000063142.1 |
Coordinates | 929440..929742 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NED09_RS04485 (925950) | 925950..928100 | + | 2151 | WP_000379928.1 | pyruvate/proton symporter BtsT | - |
NED09_RS04490 (928195) | 928195..928398 | + | 204 | WP_000460616.1 | YbdD/YjiX family protein | - |
NED09_RS04495 (928409) | 928409..929365 | + | 957 | WP_000187843.1 | GTPase | - |
NED09_RS04500 (929440) | 929440..929742 | - | 303 | WP_000063142.1 | BrnA antitoxin family protein | Antitoxin |
NED09_RS04505 (929729) | 929729..930016 | - | 288 | WP_001131963.1 | BrnT family toxin | Toxin |
NED09_RS04510 (930433) | 930433..931689 | + | 1257 | Protein_874 | NERD domain-containing protein/DEAD/DEAH box helicase | - |
NED09_RS04515 (931683) | 931683..931862 | + | 180 | Protein_875 | DNA methyltransferase | - |
NED09_RS04520 (931852) | 931852..933156 | + | 1305 | WP_000863534.1 | type I restriction-modification protein specificity subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11294.80 Da Isoelectric Point: 9.5894
>T282703 WP_001131963.1 NZ_CP126166:c930016-929729 [Salmonella enterica subsp. enterica]
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKAKSNLRKHGVRFEDAVLVFDDPRHLSRQERYENGEYRWQTLGLVHGIVVILVAHSVRFESGFEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|