Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 312318..312938 | Replicon | chromosome |
| Accession | NZ_CP126166 | ||
| Organism | Salmonella enterica subsp. enterica strain CRSE-01 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | NED09_RS01525 | Protein ID | WP_001280991.1 |
| Coordinates | 312720..312938 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | NED09_RS01520 | Protein ID | WP_000344807.1 |
| Coordinates | 312318..312692 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NED09_RS01510 (307457) | 307457..308650 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NED09_RS01515 (308673) | 308673..311822 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| NED09_RS01520 (312318) | 312318..312692 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| NED09_RS01525 (312720) | 312720..312938 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| NED09_RS01530 (313117) | 313117..313668 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| NED09_RS01535 (313786) | 313786..314256 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| NED09_RS01540 (314312) | 314312..314452 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| NED09_RS01545 (314458) | 314458..314718 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| NED09_RS01550 (314943) | 314943..316493 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
| NED09_RS01560 (316724) | 316724..317113 | + | 390 | WP_000961287.1 | MGMT family protein | - |
| NED09_RS01565 (317146) | 317146..317715 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T282700 WP_001280991.1 NZ_CP126166:312720-312938 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT282700 WP_000344807.1 NZ_CP126166:312318-312692 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|