Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 123928..124540 | Replicon | plasmid p6 |
| Accession | NZ_CP126151 | ||
| Organism | Sagittula sp. MA-2 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | QNI11_RS26970 | Protein ID | WP_088716084.1 |
| Coordinates | 124145..124540 (+) | Length | 132 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | QNI11_RS26965 | Protein ID | WP_088716083.1 |
| Coordinates | 123928..124155 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNI11_RS26950 (QNI11_26950) | 120185..121396 | - | 1212 | WP_283984049.1 | plasmid replication protein RepC | - |
| QNI11_RS26955 (QNI11_26955) | 121609..122541 | - | 933 | WP_283984050.1 | plasmid partitioning protein RepB | - |
| QNI11_RS26960 (QNI11_26960) | 122525..123718 | - | 1194 | WP_088716082.1 | plasmid partitioning protein RepA | - |
| QNI11_RS26965 (QNI11_26965) | 123928..124155 | + | 228 | WP_088716083.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QNI11_RS26970 (QNI11_26970) | 124145..124540 | + | 396 | WP_088716084.1 | PIN domain-containing protein | Toxin |
| QNI11_RS26975 (QNI11_26975) | 124619..125503 | - | 885 | WP_283984051.1 | recombinase family protein | - |
| QNI11_RS26980 (QNI11_26980) | 126051..127118 | + | 1068 | WP_283984052.1 | hypothetical protein | - |
| QNI11_RS26985 (QNI11_26985) | 127756..128343 | - | 588 | WP_038070177.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..162034 | 162034 | |
| - | flank | IS/Tn | - | - | 127756..128343 | 587 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 132 a.a. Molecular weight: 14244.23 Da Isoelectric Point: 4.1653
>T282699 WP_088716084.1 NZ_CP126151:124145-124540 [Sagittula sp. MA-2]
MSAEFADTNVVLYLLDDGPKADRAEVILGQGPRISVQVLNETLVNCRRKAGLSWEEAAAFLEGVRSLCPVEDLTVQTHDV
GRALAERYGFSIYDAMIVASALVAGCTTLWSEDMQDGLLVEGQLRIVNPFA
MSAEFADTNVVLYLLDDGPKADRAEVILGQGPRISVQVLNETLVNCRRKAGLSWEEAAAFLEGVRSLCPVEDLTVQTHDV
GRALAERYGFSIYDAMIVASALVAGCTTLWSEDMQDGLLVEGQLRIVNPFA
Download Length: 396 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|