Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 240358..240994 | Replicon | chromosome |
Accession | NZ_CP126144 | ||
Organism | Neobacillus sp. 114 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K6DRS5 |
Locus tag | QNN06_RS01285 | Protein ID | WP_007083556.1 |
Coordinates | 240644..240994 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | QNN06_RS01280 | Protein ID | WP_213120931.1 |
Coordinates | 240358..240639 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNN06_RS01260 | 236669..237259 | - | 591 | WP_213120935.1 | rhomboid family intramembrane serine protease | - |
QNN06_RS01265 | 237350..237703 | + | 354 | WP_284036783.1 | holo-ACP synthase | - |
QNN06_RS01270 | 237870..238883 | + | 1014 | WP_213148132.1 | outer membrane lipoprotein carrier protein LolA | - |
QNN06_RS01275 | 239016..240173 | + | 1158 | WP_284036784.1 | alanine racemase | - |
QNN06_RS01280 | 240358..240639 | + | 282 | WP_213120931.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QNN06_RS01285 | 240644..240994 | + | 351 | WP_007083556.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNN06_RS01290 | 241737..243911 | + | 2175 | WP_284036785.1 | Tex family protein | - |
QNN06_RS01295 | 243929..244039 | - | 111 | WP_213120929.1 | cortex morphogenetic protein CmpA | - |
QNN06_RS01300 | 244134..244610 | + | 477 | WP_284036786.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13006.03 Da Isoelectric Point: 4.8998
>T282696 WP_007083556.1 NZ_CP126144:240644-240994 [Neobacillus sp. 114]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|