Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-DnaT |
Location | 16114..16636 | Replicon | plasmid unnamed2 |
Accession | NZ_CP126142 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06 |
Toxin (Protein)
Gene name | relE | Uniprot ID | D0QMR1 |
Locus tag | QNM21_RS23215 | Protein ID | WP_000220561.1 |
Coordinates | 16355..16636 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | G3CAG1 |
Locus tag | QNM21_RS23210 | Protein ID | WP_000121743.1 |
Coordinates | 16114..16365 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM21_RS23190 (QNM21_23190) | 12384..12737 | - | 354 | WP_024156393.1 | DNA distortion polypeptide 3 | - |
QNM21_RS23195 (QNM21_23195) | 12874..13320 | - | 447 | WP_001074378.1 | hypothetical protein | - |
QNM21_RS23200 (QNM21_23200) | 13324..14175 | - | 852 | WP_000435059.1 | replication initiation protein | - |
QNM21_RS23205 (QNM21_23205) | 14180..15049 | - | 870 | WP_001212191.1 | replication initiation protein | - |
QNM21_RS23210 (QNM21_23210) | 16114..16365 | + | 252 | WP_000121743.1 | plasmid stabilization protein | Antitoxin |
QNM21_RS23215 (QNM21_23215) | 16355..16636 | + | 282 | WP_000220561.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QNM21_RS23220 (QNM21_23220) | 16986..17501 | + | 516 | WP_001025387.1 | J domain-containing protein | - |
QNM21_RS23225 (QNM21_23225) | 17575..18123 | + | 549 | WP_001178641.1 | hypothetical protein | - |
QNM21_RS23230 (QNM21_23230) | 18132..18401 | + | 270 | WP_001006718.1 | hypothetical protein | - |
QNM21_RS23235 (QNM21_23235) | 18391..18633 | + | 243 | WP_000008708.1 | hypothetical protein | - |
QNM21_RS23240 (QNM21_23240) | 18727..19056 | + | 330 | WP_000866654.1 | hypothetical protein | - |
QNM21_RS23245 (QNM21_23245) | 19099..19278 | + | 180 | WP_000439079.1 | hypothetical protein | - |
QNM21_RS23250 (QNM21_23250) | 19348..19494 | + | 147 | WP_001567307.1 | hypothetical protein | - |
QNM21_RS23255 (QNM21_23255) | 19511..19783 | + | 273 | WP_000167280.1 | hypothetical protein | - |
QNM21_RS23260 (QNM21_23260) | 20109..20654 | + | 546 | WP_000757692.1 | DNA distortion polypeptide 1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(3'')-Ib / aph(6)-Id / blaTEM-40 / sul2 / tet(A) | - | 1..29336 | 29336 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11023.86 Da Isoelectric Point: 10.5938
>T282695 WP_000220561.1 NZ_CP126142:16355-16636 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S5I302 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3S5I301 |