Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 16114..16636 Replicon plasmid unnamed2
Accession NZ_CP126142
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06

Toxin (Protein)


Gene name relE Uniprot ID D0QMR1
Locus tag QNM21_RS23215 Protein ID WP_000220561.1
Coordinates 16355..16636 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag QNM21_RS23210 Protein ID WP_000121743.1
Coordinates 16114..16365 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNM21_RS23190 (QNM21_23190) 12384..12737 - 354 WP_024156393.1 DNA distortion polypeptide 3 -
QNM21_RS23195 (QNM21_23195) 12874..13320 - 447 WP_001074378.1 hypothetical protein -
QNM21_RS23200 (QNM21_23200) 13324..14175 - 852 WP_000435059.1 replication initiation protein -
QNM21_RS23205 (QNM21_23205) 14180..15049 - 870 WP_001212191.1 replication initiation protein -
QNM21_RS23210 (QNM21_23210) 16114..16365 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
QNM21_RS23215 (QNM21_23215) 16355..16636 + 282 WP_000220561.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QNM21_RS23220 (QNM21_23220) 16986..17501 + 516 WP_001025387.1 J domain-containing protein -
QNM21_RS23225 (QNM21_23225) 17575..18123 + 549 WP_001178641.1 hypothetical protein -
QNM21_RS23230 (QNM21_23230) 18132..18401 + 270 WP_001006718.1 hypothetical protein -
QNM21_RS23235 (QNM21_23235) 18391..18633 + 243 WP_000008708.1 hypothetical protein -
QNM21_RS23240 (QNM21_23240) 18727..19056 + 330 WP_000866654.1 hypothetical protein -
QNM21_RS23245 (QNM21_23245) 19099..19278 + 180 WP_000439079.1 hypothetical protein -
QNM21_RS23250 (QNM21_23250) 19348..19494 + 147 WP_001567307.1 hypothetical protein -
QNM21_RS23255 (QNM21_23255) 19511..19783 + 273 WP_000167280.1 hypothetical protein -
QNM21_RS23260 (QNM21_23260) 20109..20654 + 546 WP_000757692.1 DNA distortion polypeptide 1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3'')-Ib / aph(6)-Id / blaTEM-40 / sul2 / tet(A) - 1..29336 29336


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11023.86 Da        Isoelectric Point: 10.5938

>T282695 WP_000220561.1 NZ_CP126142:16355-16636 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADMR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT282695 WP_000121743.1 NZ_CP126142:16114-16365 [Salmonella enterica subsp. enterica serovar Enteritidis]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3S5I302

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References