Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 36328..36853 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP126141 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | I3W3D5 |
| Locus tag | QNM21_RS22970 | Protein ID | WP_001159863.1 |
| Coordinates | 36548..36853 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | M7S5D0 |
| Locus tag | QNM21_RS22965 | Protein ID | WP_000813641.1 |
| Coordinates | 36328..36546 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNM21_RS22935 (QNM21_22935) | 31942..32328 | + | 387 | WP_000751876.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| QNM21_RS22940 (QNM21_22940) | 32381..32500 | + | 120 | Protein_42 | recombinase | - |
| QNM21_RS22945 (QNM21_22945) | 32869..33858 | - | 990 | WP_000461382.1 | RepB family plasmid replication initiator protein | - |
| QNM21_RS22950 (QNM21_22950) | 34352..34647 | - | 296 | Protein_44 | cytoplasmic protein | - |
| QNM21_RS22955 (QNM21_22955) | 34659..35087 | + | 429 | Protein_45 | hypothetical protein | - |
| QNM21_RS22960 (QNM21_22960) | 35131..35652 | - | 522 | WP_077681952.1 | hypothetical protein | - |
| QNM21_RS22965 (QNM21_22965) | 36328..36546 | + | 219 | WP_000813641.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QNM21_RS22970 (QNM21_22970) | 36548..36853 | + | 306 | WP_001159863.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QNM21_RS22975 (QNM21_22975) | 36855..37145 | + | 291 | WP_001266176.1 | hypothetical protein | - |
| QNM21_RS22980 (QNM21_22980) | 37142..37663 | + | 522 | WP_000198608.1 | hypothetical protein | - |
| QNM21_RS22985 (QNM21_22985) | 37698..38480 | + | 783 | WP_000082169.1 | site-specific integrase | - |
| QNM21_RS22990 (QNM21_22990) | 38489..39202 | + | 714 | WP_000545756.1 | EAL domain-containing protein | - |
| QNM21_RS22995 (QNM21_22995) | 39227..39715 | + | 489 | WP_001075507.1 | CaiF/GrlA family transcriptional regulator | - |
| QNM21_RS23000 (QNM21_23000) | 39709..40194 | + | 486 | WP_000905606.1 | membrane protein | - |
| QNM21_RS23005 (QNM21_23005) | 40471..40758 | - | 288 | WP_071530243.1 | hypothetical protein | - |
| QNM21_RS23010 (QNM21_23010) | 40914..41474 | + | 561 | WP_000900095.1 | inverse autotransporter beta domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaTEM-40 | rck / pefD / pefC / pefA / pefB / fdeC / spvC / spvB | 1..64327 | 64327 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11587.48 Da Isoelectric Point: 6.9787
>T282694 WP_001159863.1 NZ_CP126141:36548-36853 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | I3W3D5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656ICA6 |