Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 36328..36853 Replicon plasmid unnamed1
Accession NZ_CP126141
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag QNM21_RS22970 Protein ID WP_001159863.1
Coordinates 36548..36853 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag QNM21_RS22965 Protein ID WP_000813641.1
Coordinates 36328..36546 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNM21_RS22935 (QNM21_22935) 31942..32328 + 387 WP_000751876.1 YgiW/YdeI family stress tolerance OB fold protein -
QNM21_RS22940 (QNM21_22940) 32381..32500 + 120 Protein_42 recombinase -
QNM21_RS22945 (QNM21_22945) 32869..33858 - 990 WP_000461382.1 RepB family plasmid replication initiator protein -
QNM21_RS22950 (QNM21_22950) 34352..34647 - 296 Protein_44 cytoplasmic protein -
QNM21_RS22955 (QNM21_22955) 34659..35087 + 429 Protein_45 hypothetical protein -
QNM21_RS22960 (QNM21_22960) 35131..35652 - 522 WP_077681952.1 hypothetical protein -
QNM21_RS22965 (QNM21_22965) 36328..36546 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QNM21_RS22970 (QNM21_22970) 36548..36853 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
QNM21_RS22975 (QNM21_22975) 36855..37145 + 291 WP_001266176.1 hypothetical protein -
QNM21_RS22980 (QNM21_22980) 37142..37663 + 522 WP_000198608.1 hypothetical protein -
QNM21_RS22985 (QNM21_22985) 37698..38480 + 783 WP_000082169.1 site-specific integrase -
QNM21_RS22990 (QNM21_22990) 38489..39202 + 714 WP_000545756.1 EAL domain-containing protein -
QNM21_RS22995 (QNM21_22995) 39227..39715 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
QNM21_RS23000 (QNM21_23000) 39709..40194 + 486 WP_000905606.1 membrane protein -
QNM21_RS23005 (QNM21_23005) 40471..40758 - 288 WP_071530243.1 hypothetical protein -
QNM21_RS23010 (QNM21_23010) 40914..41474 + 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaTEM-40 rck / pefD / pefC / pefA / pefB / fdeC / spvC / spvB 1..64327 64327


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T282694 WP_001159863.1 NZ_CP126141:36548-36853 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT282694 WP_000813641.1 NZ_CP126141:36328-36546 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References