Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4178813..4179594 | Replicon | chromosome |
Accession | NZ_CP126140 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B5R980 |
Locus tag | QNM21_RS20440 | Protein ID | WP_000626100.1 |
Coordinates | 4178813..4179304 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | B5R979 |
Locus tag | QNM21_RS20445 | Protein ID | WP_001110452.1 |
Coordinates | 4179301..4179594 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM21_RS20405 (4174273) | 4174273..4174620 | + | 348 | WP_000887832.1 | divalent cation tolerance protein CutA | - |
QNM21_RS20410 (4174596) | 4174596..4176299 | + | 1704 | WP_000068885.1 | protein-disulfide reductase DsbD | - |
QNM21_RS20415 (4176336) | 4176336..4176911 | + | 576 | WP_001188509.1 | transcriptional regulator | - |
QNM21_RS20425 (4177182) | 4177182..4177256 | - | 75 | Protein_3994 | helix-turn-helix domain-containing protein | - |
QNM21_RS20430 (4177636) | 4177636..4177713 | + | 78 | Protein_3995 | porin family protein | - |
QNM21_RS20435 (4177813) | 4177813..4178565 | + | 753 | WP_000842433.1 | non-specific acid phosphatase | - |
QNM21_RS20440 (4178813) | 4178813..4179304 | - | 492 | WP_000626100.1 | GNAT family N-acetyltransferase | Toxin |
QNM21_RS20445 (4179301) | 4179301..4179594 | - | 294 | WP_001110452.1 | DUF1778 domain-containing protein | Antitoxin |
QNM21_RS20450 (4179911) | 4179911..4180132 | + | 222 | WP_001576552.1 | hypothetical protein | - |
QNM21_RS20455 (4180398) | 4180398..4181273 | + | 876 | WP_000921676.1 | AraC family transcriptional regulator | - |
QNM21_RS20460 (4181270) | 4181270..4181557 | + | 288 | WP_001541332.1 | transcriptional regulator RtsB | - |
QNM21_RS20465 (4181550) | 4181550..4181732 | - | 183 | WP_001676222.1 | ATP-binding cassette domain-containing protein | - |
QNM21_RS20470 (4181857) | 4181857..4182105 | + | 249 | Protein_4003 | Ig-like domain-containing protein | - |
QNM21_RS20475 (4182217) | 4182217..4182348 | + | 132 | Protein_4004 | hypothetical protein | - |
QNM21_RS20480 (4182642) | 4182642..4183547 | - | 906 | WP_001268200.1 | YjiK family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17645.45 Da Isoelectric Point: 7.7297
>T282691 WP_000626100.1 NZ_CP126140:c4179304-4178813 [Salmonella enterica subsp. enterica serovar Enteritidis]
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
MISTPEPLHAGHILTPFCCGVDSIDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTSPGRFRRNMPDP
IPVVVLGRLAVDKSLHGQGVARALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFVPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Download Length: 98 a.a. Molecular weight: 10977.61 Da Isoelectric Point: 8.6141
>AT282691 WP_001110452.1 NZ_CP126140:c4179594-4179301 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
MPAANSMAMKRETLNLRIKPAERDLIDRAAKARGKNRTDFVLEAARAAAEEALIEQRIIMADPEAYQEFLVRLDQTPSPN
AALRKTMQTPAPWEQEK
Download Length: 294 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A656IQ80 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7AK7 | |
AlphaFold DB | A0A5I1DGA4 |