Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4071917..4072433 | Replicon | chromosome |
| Accession | NZ_CP126140 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | B5R9I9 |
| Locus tag | QNM21_RS19865 | Protein ID | WP_000220582.1 |
| Coordinates | 4071917..4072201 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V7ISI8 |
| Locus tag | QNM21_RS19870 | Protein ID | WP_000212724.1 |
| Coordinates | 4072191..4072433 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNM21_RS19850 (4067128) | 4067128..4068780 | + | 1653 | WP_000155048.1 | alpha,alpha-phosphotrehalase | - |
| QNM21_RS19855 (4069189) | 4069189..4071327 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| QNM21_RS19860 (4071449) | 4071449..4071913 | + | 465 | WP_001268859.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| QNM21_RS19865 (4071917) | 4071917..4072201 | - | 285 | WP_000220582.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QNM21_RS19870 (4072191) | 4072191..4072433 | - | 243 | WP_000212724.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| QNM21_RS19875 (4072511) | 4072511..4074424 | - | 1914 | WP_001212142.1 | BglG family transcription antiterminator | - |
| QNM21_RS19880 (4074441) | 4074441..4075181 | - | 741 | WP_000779259.1 | KDGP aldolase family protein | - |
| QNM21_RS19885 (4075178) | 4075178..4076296 | - | 1119 | WP_001139169.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
| QNM21_RS19890 (4076280) | 4076280..4077413 | - | 1134 | WP_000459957.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10912.66 Da Isoelectric Point: 9.6743
>T282690 WP_000220582.1 NZ_CP126140:c4072201-4071917 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEFDPRALKEWHKLGDTVQAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A656ILJ8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5H5JRI5 |