Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4030792..4031342 Replicon chromosome
Accession NZ_CP126140
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06

Toxin (Protein)


Gene name ccdB Uniprot ID M7RJ32
Locus tag QNM21_RS19660 Protein ID WP_001199743.1
Coordinates 4030792..4031100 (-) Length 103 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7RP97
Locus tag QNM21_RS19665 Protein ID WP_001118105.1
Coordinates 4031103..4031342 (-) Length 80 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNM21_RS19640 (4027366) 4027366..4028106 - 741 WP_001676217.1 SEF14/SEF18 fimbria chaperone SefB -
QNM21_RS19645 (4028228) 4028228..4028758 - 531 WP_000909461.1 SEF14 fimbria major subunit SefA -
QNM21_RS19650 (4029081) 4029081..4030214 + 1134 Protein_3844 IS3 family transposase -
QNM21_RS19655 (4030246) 4030246..4030386 - 141 Protein_3845 Arm DNA-binding domain-containing protein -
QNM21_RS19660 (4030792) 4030792..4031100 - 309 WP_001199743.1 CcdB family protein Toxin
QNM21_RS19665 (4031103) 4031103..4031342 - 240 WP_001118105.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QNM21_RS19670 (4031451) 4031451..4031699 - 249 WP_000168388.1 ribbon-helix-helix domain-containing protein -
QNM21_RS19675 (4031890) 4031890..4032321 - 432 Protein_3849 helix-turn-helix domain-containing protein -
QNM21_RS19685 (4033078) 4033078..4034097 + 1020 WP_000152558.1 NAD(P)-dependent alcohol dehydrogenase -
QNM21_RS19690 (4034125) 4034125..4034655 - 531 WP_000896758.1 gluconokinase -
QNM21_RS19695 (4034872) 4034872..4035903 + 1032 WP_000453347.1 L-idonate 5-dehydrogenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside IScluster/Tn - - 4029173..4032276 3103


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-101)

Antitoxin

Post-segregation antitoxin CcdA

(9-79)


Sequences

Toxin        


Download         Length: 103 a.a.        Molecular weight: 11845.67 Da        Isoelectric Point: 6.7228

>T282689 WP_001199743.1 NZ_CP126140:c4031100-4030792 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF

Download         Length: 309 bp

Antitoxin


Download         Length: 80 a.a.        Molecular weight: 8719.90 Da        Isoelectric Point: 6.4633

>AT282689 WP_001118105.1 NZ_CP126140:c4031342-4031103 [Salmonella enterica subsp. enterica serovar Enteritidis]
MPGMSVRHKKTVSVTLEPALLQQARDAGINLSAVLTAALKEEISATGVERWKAENRAGLQELNRITDEHGLLSDDYRTF

Download         Length: 240 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6C6Z9V9

Antitoxin

Source ID Structure
AlphaFold DB A0A5H9SZK8

References