Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 4030792..4031342 | Replicon | chromosome |
Accession | NZ_CP126140 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | QNM21_RS19660 | Protein ID | WP_001199743.1 |
Coordinates | 4030792..4031100 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | M7RP97 |
Locus tag | QNM21_RS19665 | Protein ID | WP_001118105.1 |
Coordinates | 4031103..4031342 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM21_RS19640 (4027366) | 4027366..4028106 | - | 741 | WP_001676217.1 | SEF14/SEF18 fimbria chaperone SefB | - |
QNM21_RS19645 (4028228) | 4028228..4028758 | - | 531 | WP_000909461.1 | SEF14 fimbria major subunit SefA | - |
QNM21_RS19650 (4029081) | 4029081..4030214 | + | 1134 | Protein_3844 | IS3 family transposase | - |
QNM21_RS19655 (4030246) | 4030246..4030386 | - | 141 | Protein_3845 | Arm DNA-binding domain-containing protein | - |
QNM21_RS19660 (4030792) | 4030792..4031100 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
QNM21_RS19665 (4031103) | 4031103..4031342 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
QNM21_RS19670 (4031451) | 4031451..4031699 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
QNM21_RS19675 (4031890) | 4031890..4032321 | - | 432 | Protein_3849 | helix-turn-helix domain-containing protein | - |
QNM21_RS19685 (4033078) | 4033078..4034097 | + | 1020 | WP_000152558.1 | NAD(P)-dependent alcohol dehydrogenase | - |
QNM21_RS19690 (4034125) | 4034125..4034655 | - | 531 | WP_000896758.1 | gluconokinase | - |
QNM21_RS19695 (4034872) | 4034872..4035903 | + | 1032 | WP_000453347.1 | L-idonate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | IScluster/Tn | - | - | 4029173..4032276 | 3103 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T282689 WP_001199743.1 NZ_CP126140:c4031100-4030792 [Salmonella enterica subsp. enterica serovar Enteritidis]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H9SZK8 |