Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3411000..3411620 | Replicon | chromosome |
Accession | NZ_CP126140 | ||
Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | QNM21_RS16795 | Protein ID | WP_001280991.1 |
Coordinates | 3411402..3411620 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | QNM21_RS16790 | Protein ID | WP_000344807.1 |
Coordinates | 3411000..3411374 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNM21_RS16780 (3406139) | 3406139..3407332 | + | 1194 | WP_001039202.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QNM21_RS16785 (3407355) | 3407355..3410504 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
QNM21_RS16790 (3411000) | 3411000..3411374 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
QNM21_RS16795 (3411402) | 3411402..3411620 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
QNM21_RS16800 (3411799) | 3411799..3412350 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
QNM21_RS16805 (3412468) | 3412468..3412938 | + | 471 | WP_000136183.1 | YlaC family protein | - |
QNM21_RS16810 (3412994) | 3412994..3413134 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
QNM21_RS16815 (3413140) | 3413140..3413400 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
QNM21_RS16820 (3413625) | 3413625..3415175 | + | 1551 | WP_000213140.1 | EAL domain-containing protein | - |
QNM21_RS16830 (3415406) | 3415406..3415795 | + | 390 | WP_000961287.1 | MGMT family protein | - |
QNM21_RS16835 (3415828) | 3415828..3416397 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T282685 WP_001280991.1 NZ_CP126140:3411402-3411620 [Salmonella enterica subsp. enterica serovar Enteritidis]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT282685 WP_000344807.1 NZ_CP126140:3411000-3411374 [Salmonella enterica subsp. enterica serovar Enteritidis]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|