282675

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 310297..310883 Replicon chromosome
Accession NZ_CP126140
Organism Salmonella enterica subsp. enterica serovar Enteritidis strain DSE06

Toxin (Protein)


Gene name doc Uniprot ID A0A3V9X0E4
Locus tag QNM21_RS01415 Protein ID WP_000174964.1
Coordinates 310515..310883 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID V7IU48
Locus tag QNM21_RS01410 Protein ID WP_001522145.1
Coordinates 310297..310518 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNM21_RS01385 (305318) 305318..306427 + 1110 WP_000822978.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
QNM21_RS01390 (306487) 306487..307413 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QNM21_RS01395 (307410) 307410..308687 + 1278 WP_000803764.1 branched chain amino acid ABC transporter permease LivM -
QNM21_RS01400 (308684) 308684..309451 + 768 WP_000082080.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QNM21_RS01405 (309453) 309453..310166 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QNM21_RS01410 (310297) 310297..310518 + 222 WP_001522145.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QNM21_RS01415 (310515) 310515..310883 + 369 WP_000174964.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QNM21_RS01420 (311142) 311142..312458 + 1317 WP_000624755.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QNM21_RS01425 (312563) 312563..313450 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QNM21_RS01430 (313447) 313447..314292 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QNM21_RS01435 (314294) 314294..315364 + 1071 WP_000907840.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 307410..316101 8691


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-114)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13601.91 Da        Isoelectric Point: 6.7252

>T282675 WP_000174964.1 NZ_CP126140:310515-310883 [Salmonella enterica subsp. enterica serovar Enteritidis]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLNQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIVVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8166.17 Da        Isoelectric Point: 5.0775

>AT282675 WP_001522145.1 NZ_CP126140:310297-310518 [Salmonella enterica subsp. enterica serovar Enteritidis]
MRTVNYSEARQNLAEVLESAVTAGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3V9X0E4

Antitoxin

Source ID Structure

References