Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 50056..50581 Replicon plasmid unnamed1
Accession NZ_CP126139
Organism Salmonella enterica subsp. enterica serovar Kottbus strain DSK01

Toxin (Protein)


Gene name ccdB Uniprot ID I3W3D5
Locus tag QNM33_RS24195 Protein ID WP_001159863.1
Coordinates 50276..50581 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag QNM33_RS24190 Protein ID WP_000813641.1
Coordinates 50056..50274 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QNM33_RS24160 (QNM33_24160) 45343..45724 + 382 Protein_51 YgiW/YdeI family stress tolerance OB fold protein -
QNM33_RS24165 (QNM33_24165) 45893..46337 + 445 Protein_52 tyrosine-type recombinase/integrase -
QNM33_RS24170 (QNM33_24170) 46596..47585 - 990 WP_001527061.1 RepB family plasmid replication initiator protein -
QNM33_RS24175 (QNM33_24175) 48079..48375 - 297 WP_001687482.1 hypothetical protein -
QNM33_RS24180 (QNM33_24180) 48387..48815 + 429 Protein_55 hypothetical protein -
QNM33_RS24185 (QNM33_24185) 48859..49380 - 522 WP_010999942.1 hypothetical protein -
QNM33_RS24190 (QNM33_24190) 50056..50274 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QNM33_RS24195 (QNM33_24195) 50276..50581 + 306 WP_001159863.1 type II toxin-antitoxin system toxin CcdB Toxin
QNM33_RS24200 (QNM33_24200) 50583..50873 + 291 WP_001266176.1 hypothetical protein -
QNM33_RS24205 (QNM33_24205) 50870..51391 + 522 WP_000198608.1 hypothetical protein -
QNM33_RS24210 (QNM33_24210) 51426..52208 + 783 WP_000082169.1 site-specific integrase -
QNM33_RS24215 (QNM33_24215) 52217..52768 + 552 WP_000545754.1 EAL domain-containing protein -
QNM33_RS24220 (QNM33_24220) 52955..53443 + 489 WP_001075507.1 CaiF/GrlA family transcriptional regulator -
QNM33_RS24225 (QNM33_24225) 53437..53922 + 486 WP_000905606.1 membrane protein -
QNM33_RS24230 (QNM33_24230) 54199..54486 - 288 WP_071530243.1 hypothetical protein -
QNM33_RS24235 (QNM33_24235) 54642..55202 + 561 WP_000900095.1 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - rck / pefD / pefC / pefA / pefB / fdeC / spvC / spvB 1..93855 93855
- flank IS/Tn - - 55269..55619 350


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11587.48 Da        Isoelectric Point: 6.9787

>T282673 WP_001159863.1 NZ_CP126139:50276-50581 [Salmonella enterica subsp. enterica serovar Kottbus]
MQFKVYTCKRESRYRLFVDVQSDIIDTPGRRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT282673 WP_000813641.1 NZ_CP126139:50056-50274 [Salmonella enterica subsp. enterica serovar Kottbus]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB I3W3D5

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References