Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 3723849..3724666 | Replicon | chromosome |
| Accession | NZ_CP126137 | ||
| Organism | Morganella morganii strain Sample-M-2023 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | - |
| Locus tag | QLX58_RS17610 | Protein ID | WP_015422406.1 |
| Coordinates | 3723849..3724355 (-) | Length | 169 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | J7TDK6 |
| Locus tag | QLX58_RS17615 | Protein ID | WP_004236533.1 |
| Coordinates | 3724358..3724666 (-) | Length | 103 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLX58_RS17570 (QLX58_17570) | 3719208..3719831 | - | 624 | WP_004236525.1 | thiol:disulfide interchange protein DsbA | - |
| QLX58_RS17575 (QLX58_17575) | 3719850..3720845 | - | 996 | WP_004236526.1 | serine/threonine protein kinase | - |
| QLX58_RS17580 (QLX58_17580) | 3720845..3721114 | - | 270 | WP_124537799.1 | YihD family protein | - |
| QLX58_RS17585 (QLX58_17585) | 3721335..3721907 | + | 573 | Protein_3409 | molybdenum cofactor guanylyltransferase MobA | - |
| QLX58_RS17590 (QLX58_17590) | 3721914..3722432 | + | 519 | WP_223302449.1 | molybdopterin-guanine dinucleotide biosynthesis protein MobB | - |
| QLX58_RS17595 (QLX58_17595) | 3722647..3722949 | + | 303 | WP_004240743.1 | HdeA/HdeB family chaperone | - |
| QLX58_RS17600 (QLX58_17600) | 3723077..3723598 | + | 522 | WP_015422407.1 | isopentenyl-diphosphate Delta-isomerase | - |
| QLX58_RS17605 (QLX58_17605) | 3723595..3723735 | + | 141 | WP_004236531.1 | hypothetical protein | - |
| QLX58_RS17610 (QLX58_17610) | 3723849..3724355 | - | 507 | WP_015422406.1 | GNAT family N-acetyltransferase | Toxin |
| QLX58_RS17615 (QLX58_17615) | 3724358..3724666 | - | 309 | WP_004236533.1 | DUF1778 domain-containing protein | Antitoxin |
| QLX58_RS17620 (QLX58_17620) | 3724798..3726150 | - | 1353 | WP_124537800.1 | glutathione-disulfide reductase | - |
| QLX58_RS17625 (QLX58_17625) | 3726219..3727061 | - | 843 | WP_004236535.1 | 23S rRNA (adenine(2030)-N(6))-methyltransferase RlmJ | - |
| QLX58_RS17630 (QLX58_17630) | 3727251..3727640 | + | 390 | WP_004236536.1 | DUF1090 domain-containing protein | - |
| QLX58_RS17635 (QLX58_17635) | 3728052..3729044 | + | 993 | WP_046024794.1 | inner membrane protein YhjD | - |
| QLX58_RS17640 (QLX58_17640) | 3729152..3729358 | + | 207 | WP_004236540.1 | 4-oxalocrotonate tautomerase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 169 a.a. Molecular weight: 18565.43 Da Isoelectric Point: 9.9508
>T282651 WP_015422406.1 NZ_CP126137:c3724355-3723849 [Morganella morganii]
MNLTAPEPLQQHHDFTVFQSGEESLNHWLKTRALQNQQSGASRTFVVCHHNRIMAYYALSTGVITCSQAAGRFRRNMPPE
IPVILPGRLAVDESVKGRGIGRGLIKDAALRVLQAAGIVGIRGIVVRALSDNARRFYEHTGFMPSPADPMLLMITLRDLQ
LATGIYSE
MNLTAPEPLQQHHDFTVFQSGEESLNHWLKTRALQNQQSGASRTFVVCHHNRIMAYYALSTGVITCSQAAGRFRRNMPPE
IPVILPGRLAVDESVKGRGIGRGLIKDAALRVLQAAGIVGIRGIVVRALSDNARRFYEHTGFMPSPADPMLLMITLRDLQ
LATGIYSE
Download Length: 507 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|