Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Xre-MNT/HTH_26(antitoxin) |
Location | 2342389..2343497 | Replicon | chromosome |
Accession | NZ_CP126128 | ||
Organism | Desemzia incerta strain EGm139 |
Toxin (Protein)
Gene name | MNTss | Uniprot ID | A0A2H4HI44 |
Locus tag | QNK01_RS11375 | Protein ID | WP_029170889.1 |
Coordinates | 2342389..2343258 (-) | Length | 290 a.a. |
Antitoxin (Protein)
Gene name | Xress | Uniprot ID | - |
Locus tag | QNK01_RS11380 | Protein ID | WP_000205227.1 |
Coordinates | 2343273..2343497 (-) | Length | 75 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNK01_RS11340 (QNK01_11340) | 2337741..2338139 | - | 399 | WP_188205206.1 | cytidine deaminase | - |
QNK01_RS11345 (QNK01_11345) | 2338193..2339128 | - | 936 | WP_284029424.1 | aminoglycoside phosphotransferase family protein | - |
QNK01_RS11350 (QNK01_11350) | 2339166..2339756 | - | 591 | WP_188205204.1 | GrpB family protein | - |
QNK01_RS11355 (QNK01_11355) | 2339776..2339994 | - | 219 | WP_188205203.1 | hypothetical protein | - |
QNK01_RS11360 (QNK01_11360) | 2340076..2340714 | - | 639 | WP_188205202.1 | hypothetical protein | - |
QNK01_RS11365 (QNK01_11365) | 2340778..2341641 | - | 864 | WP_284029425.1 | aminoglycoside 6-adenylyltransferase | - |
QNK01_RS11370 (QNK01_11370) | 2341674..2342408 | - | 735 | WP_284029426.1 | class I SAM-dependent methyltransferase | - |
QNK01_RS11375 (QNK01_11375) | 2342389..2343258 | - | 870 | WP_029170889.1 | nucleotidyltransferase domain-containing protein | Toxin |
QNK01_RS11380 (QNK01_11380) | 2343273..2343497 | - | 225 | WP_000205227.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QNK01_RS11385 (QNK01_11385) | 2343640..2344461 | - | 822 | Protein_2167 | recombinase zinc beta ribbon domain-containing protein | - |
QNK01_RS11390 (QNK01_11390) | 2345149..2345952 | - | 804 | WP_002294514.1 | lincosamide nucleotidyltransferase Lnu(B) | - |
QNK01_RS11395 (QNK01_11395) | 2346006..2347490 | - | 1485 | WP_002294513.1 | ABC-F type ribosomal protection protein Lsa(E) | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | ant(6)-Ia / lnu(B) / lsa(E) / msr(D) / mef(A) | - | 2339166..2358455 | 19289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 290 a.a. Molecular weight: 32820.25 Da Isoelectric Point: 4.9564
>T282649 WP_029170889.1 NZ_CP126128:c2343258-2342389 [Desemzia incerta]
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIMKDTEHGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAETY
PNALQKSLVNFFMFEAGFSLMFVKANSGTDDKYYIAGHVFRIVSCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
MVGNVIQIVTEKLSSLPFIEGIVLGGSRARGTHTENSDIDIGIYYNSDSFDLTAINQIATELDDKNRNNLVVPPGAWGDW
INGGGWLFINGYHVDLILRDIKRVEQIMKDTEHGIVTANYQTGHPHGYISAMYRGELAISKILYAKNESLCELKKQAETY
PNALQKSLVNFFMFEAGFSLMFVKANSGTDDKYYIAGHVFRIVSCLNQVLFACNNAYCINEKKAIKLLETFEHKPEKYTE
KVNHIFEVLGISLFECYDMTEKLYNEVNEIVSEINNFLNEESSDERKQI
Download Length: 870 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|