Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 171813..172387 | Replicon | chromosome |
| Accession | NZ_CP126128 | ||
| Organism | Desemzia incerta strain EGm139 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QNK01_RS00795 | Protein ID | WP_284029557.1 |
| Coordinates | 171813..172151 (-) | Length | 113 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | QNK01_RS00800 | Protein ID | WP_284029558.1 |
| Coordinates | 172145..172387 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNK01_RS00775 (QNK01_00775) | 167990..169576 | - | 1587 | WP_284029553.1 | Mur ligase family protein | - |
| QNK01_RS00780 (QNK01_00780) | 169830..170231 | + | 402 | WP_284029554.1 | nucleoside-diphosphate kinase | - |
| QNK01_RS00785 (QNK01_00785) | 170311..171075 | - | 765 | WP_284029555.1 | SDR family oxidoreductase | - |
| QNK01_RS00790 (QNK01_00790) | 171205..171387 | - | 183 | WP_284029556.1 | hypothetical protein | - |
| QNK01_RS00795 (QNK01_00795) | 171813..172151 | - | 339 | WP_284029557.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QNK01_RS00800 (QNK01_00800) | 172145..172387 | - | 243 | WP_284029558.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QNK01_RS00805 (QNK01_00805) | 173474..174664 | + | 1191 | WP_000997694.1 | IS256-like element ISLgar5 family transposase | - |
| QNK01_RS00810 (QNK01_00810) | 174799..176988 | + | 2190 | WP_000470931.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(M) | - | 108393..327644 | 219251 | |
| - | flank | IS/Tn | - | - | 173474..174664 | 1190 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13050.19 Da Isoelectric Point: 9.6251
>T282648 WP_284029557.1 NZ_CP126128:c172151-171813 [Desemzia incerta]
MVKQGDIIKMNLDPKQGHEQQGYRPYICLNYHRVSDYANIAVFAPILNAERNYPLYVPLKGTKSSGKVLLDQLVTIDYNT
RKYQYVESVPEKLTDELLMKVKVIFQKNEKIK
MVKQGDIIKMNLDPKQGHEQQGYRPYICLNYHRVSDYANIAVFAPILNAERNYPLYVPLKGTKSSGKVLLDQLVTIDYNT
RKYQYVESVPEKLTDELLMKVKVIFQKNEKIK
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|