Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 243248..243884 | Replicon | chromosome |
Accession | NZ_CP126116 | ||
Organism | Metabacillus sp. CT-WN-B3 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2N5FBL1 |
Locus tag | QLQ22_RS01355 | Protein ID | WP_029286376.1 |
Coordinates | 243534..243884 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A2N5FBR6 |
Locus tag | QLQ22_RS01350 | Protein ID | WP_029286378.1 |
Coordinates | 243248..243529 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ22_RS01330 (QLQ22_01330) | 239278..239871 | - | 594 | WP_223439017.1 | rhomboid family intramembrane serine protease | - |
QLQ22_RS01335 (QLQ22_01335) | 239974..240339 | + | 366 | WP_284015867.1 | holo-ACP synthase | - |
QLQ22_RS01340 (QLQ22_01340) | 240485..241495 | + | 1011 | WP_223439019.1 | outer membrane lipoprotein carrier protein LolA | - |
QLQ22_RS01345 (QLQ22_01345) | 241920..243101 | + | 1182 | WP_223439020.1 | alanine racemase | - |
QLQ22_RS01350 (QLQ22_01350) | 243248..243529 | + | 282 | WP_029286378.1 | YlcI/YnfO family protein | Antitoxin |
QLQ22_RS01355 (QLQ22_01355) | 243534..243884 | + | 351 | WP_029286376.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QLQ22_RS01360 (QLQ22_01360) | 244022..244858 | + | 837 | WP_223439021.1 | STAS domain-containing protein | - |
QLQ22_RS01365 (QLQ22_01365) | 244855..245220 | + | 366 | WP_101569209.1 | STAS domain-containing protein | - |
QLQ22_RS01370 (QLQ22_01370) | 245223..245624 | + | 402 | WP_070878720.1 | anti-sigma regulatory factor | - |
QLQ22_RS01375 (QLQ22_01375) | 245636..246646 | + | 1011 | WP_223439022.1 | PP2C family protein-serine/threonine phosphatase | - |
QLQ22_RS01380 (QLQ22_01380) | 246709..247041 | + | 333 | WP_223439023.1 | anti-sigma factor antagonist | - |
QLQ22_RS01385 (QLQ22_01385) | 247038..247520 | + | 483 | WP_223439024.1 | anti-sigma B factor RsbW | - |
QLQ22_RS01390 (QLQ22_01390) | 247486..248274 | + | 789 | WP_070878724.1 | RNA polymerase sigma factor SigB | - |
QLQ22_RS01395 (QLQ22_01395) | 248274..248873 | + | 600 | WP_223439025.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13036.06 Da Isoelectric Point: 4.8781
>T282645 WP_029286376.1 NZ_CP126116:243534-243884 [Metabacillus sp. CT-WN-B3]
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDSKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIIAAITAQIQKAKLPTHVEIDSKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N5FBL1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2N5FBR6 |