Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 2915111..2915730 | Replicon | chromosome |
Accession | NZ_CP126113 | ||
Organism | Siminovitchia fortis strain XLM16 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | QNH23_RS14640 | Protein ID | WP_120070206.1 |
Coordinates | 2915111..2915437 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | QNH23_RS14645 | Protein ID | WP_235870277.1 |
Coordinates | 2915437..2915730 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH23_RS14620 (QNH23_14620) | 2910767..2912005 | - | 1239 | WP_120070213.1 | Zn-dependent hydrolase | - |
QNH23_RS14625 (QNH23_14625) | 2912178..2913563 | + | 1386 | WP_120070211.1 | sigma 54-interacting transcriptional regulator | - |
QNH23_RS14630 (QNH23_14630) | 2913680..2914792 | + | 1113 | WP_283903040.1 | agmatine deiminase | - |
QNH23_RS14640 (QNH23_14640) | 2915111..2915437 | - | 327 | WP_120070206.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QNH23_RS14645 (QNH23_14645) | 2915437..2915730 | - | 294 | WP_235870277.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
QNH23_RS14650 (QNH23_14650) | 2916056..2916184 | - | 129 | WP_268920374.1 | hypothetical protein | - |
QNH23_RS14655 (QNH23_14655) | 2916202..2917716 | - | 1515 | WP_120070203.1 | osmoprotectant update ABC transporter permease/substrate-binding subunit OpuFB | - |
QNH23_RS14660 (QNH23_14660) | 2917709..2918659 | - | 951 | WP_120070201.1 | ABC transporter ATP-binding protein | - |
QNH23_RS14665 (QNH23_14665) | 2918807..2919592 | + | 786 | WP_120070198.1 | TIGR00266 family protein | - |
QNH23_RS14670 (QNH23_14670) | 2919618..2920268 | - | 651 | WP_120070195.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11894.69 Da Isoelectric Point: 7.1342
>T282642 WP_120070206.1 NZ_CP126113:c2915437-2915111 [Siminovitchia fortis]
MSVPDRGDLVYVNFNPQTGHEQAGNRPGIVLSPKEFNQVTGFASICLITKTARGWGFEVKLPEGLAFQGVILTDQVKNLD
WAARNLKVKGKAPDELVEECLAKIHTFL
MSVPDRGDLVYVNFNPQTGHEQAGNRPGIVLSPKEFNQVTGFASICLITKTARGWGFEVKLPEGLAFQGVILTDQVKNLD
WAARNLKVKGKAPDELVEECLAKIHTFL
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|