Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 2699784..2700420 | Replicon | chromosome |
| Accession | NZ_CP126113 | ||
| Organism | Siminovitchia fortis strain XLM16 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A429X0R4 |
| Locus tag | QNH23_RS13675 | Protein ID | WP_018709209.1 |
| Coordinates | 2699784..2700134 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | QNH23_RS13680 | Protein ID | WP_018709208.1 |
| Coordinates | 2700139..2700420 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH23_RS13645 (QNH23_13645) | 2694964..2695293 | - | 330 | WP_120075882.1 | STAS domain-containing protein | - |
| QNH23_RS13650 (QNH23_13650) | 2695371..2696381 | - | 1011 | WP_120075884.1 | PP2C family protein-serine/threonine phosphatase | - |
| QNH23_RS13655 (QNH23_13655) | 2696396..2696797 | - | 402 | WP_120075886.1 | anti-sigma regulatory factor | - |
| QNH23_RS13660 (QNH23_13660) | 2696802..2697158 | - | 357 | WP_120075887.1 | STAS domain-containing protein | - |
| QNH23_RS13665 (QNH23_13665) | 2697155..2697991 | - | 837 | WP_120075889.1 | STAS domain-containing protein | - |
| QNH23_RS13670 (QNH23_13670) | 2698296..2699594 | - | 1299 | WP_144463775.1 | IS1380 family transposase | - |
| QNH23_RS13675 (QNH23_13675) | 2699784..2700134 | - | 351 | WP_018709209.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QNH23_RS13680 (QNH23_13680) | 2700139..2700420 | - | 282 | WP_018709208.1 | YlcI/YnfO family protein | Antitoxin |
| QNH23_RS13685 (QNH23_13685) | 2700858..2702024 | - | 1167 | WP_120075928.1 | alanine racemase | - |
| QNH23_RS13690 (QNH23_13690) | 2702212..2703963 | - | 1752 | WP_120075929.1 | adenine deaminase | - |
| QNH23_RS13695 (QNH23_13695) | 2703992..2705359 | - | 1368 | WP_120075932.1 | NCS2 family permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2698296..2699594 | 1298 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12947.99 Da Isoelectric Point: 5.1663
>T282641 WP_018709209.1 NZ_CP126113:c2700134-2699784 [Siminovitchia fortis]
MVVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDSKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDEEMMEKVDDALQISLGLIAF
MVVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDSKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDEEMMEKVDDALQISLGLIAF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|