Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
| Location | 279840..280479 | Replicon | chromosome |
| Accession | NZ_CP126112 | ||
| Organism | Peribacillus simplex strain WH6 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | QNH37_RS01455 | Protein ID | WP_034306610.1 |
| Coordinates | 280129..280479 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | QNH37_RS01450 | Protein ID | WP_034306380.1 |
| Coordinates | 279840..280121 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH37_RS01430 (QNH37_01430) | 275974..276564 | - | 591 | WP_283900215.1 | rhomboid family intramembrane serine protease | - |
| QNH37_RS01435 (QNH37_01435) | 276673..277023 | + | 351 | WP_283900216.1 | holo-ACP synthase | - |
| QNH37_RS01440 (QNH37_01440) | 277268..278272 | + | 1005 | WP_283900217.1 | outer membrane lipoprotein carrier protein LolA | - |
| QNH37_RS01445 (QNH37_01445) | 278495..279679 | + | 1185 | WP_283900218.1 | alanine racemase | - |
| QNH37_RS01450 (QNH37_01450) | 279840..280121 | + | 282 | WP_034306380.1 | antitoxin EndoAI | Antitoxin |
| QNH37_RS01455 (QNH37_01455) | 280129..280479 | + | 351 | WP_034306610.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QNH37_RS01460 (QNH37_01460) | 280894..281721 | + | 828 | WP_048682050.1 | RsbT co-antagonist protein RsbRA | - |
| QNH37_RS01465 (QNH37_01465) | 281724..282080 | + | 357 | WP_076373142.1 | STAS domain-containing protein | - |
| QNH37_RS01470 (QNH37_01470) | 282084..282485 | + | 402 | WP_048682056.1 | anti-sigma regulatory factor | - |
| QNH37_RS01475 (QNH37_01475) | 282495..283505 | + | 1011 | WP_283900219.1 | PP2C family protein-serine/threonine phosphatase | - |
| QNH37_RS01480 (QNH37_01480) | 283565..283897 | + | 333 | WP_098372176.1 | anti-sigma factor antagonist | - |
| QNH37_RS01485 (QNH37_01485) | 283894..284367 | + | 474 | WP_098372177.1 | anti-sigma B factor RsbW | - |
| QNH37_RS01490 (QNH37_01490) | 284345..285133 | + | 789 | WP_283900221.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12955.06 Da Isoelectric Point: 7.2029
>T282640 WP_034306610.1 NZ_CP126112:280129-280479 [Peribacillus simplex]
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|