Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 402094..402730 | Replicon | chromosome |
Accession | NZ_CP126110 | ||
Organism | Neobacillus sp. WH10 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K6DRS5 |
Locus tag | QNH20_RS02020 | Protein ID | WP_007083556.1 |
Coordinates | 402380..402730 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A1S2RGM2 |
Locus tag | QNH20_RS02015 | Protein ID | WP_071354167.1 |
Coordinates | 402094..402375 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH20_RS01995 (QNH20_01995) | 397928..398656 | - | 729 | WP_283921282.1 | rhomboid family intramembrane serine protease | - |
QNH20_RS02000 (QNH20_02000) | 398750..399097 | + | 348 | WP_283921283.1 | holo-ACP synthase | - |
QNH20_RS02005 (QNH20_02005) | 399523..400536 | + | 1014 | WP_283921284.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH20_RS02010 (QNH20_02010) | 400667..401830 | + | 1164 | WP_283921285.1 | alanine racemase | - |
QNH20_RS02015 (QNH20_02015) | 402094..402375 | + | 282 | WP_071354167.1 | YlcI/YnfO family protein | Antitoxin |
QNH20_RS02020 (QNH20_02020) | 402380..402730 | + | 351 | WP_007083556.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNH20_RS02025 (QNH20_02025) | 402895..405081 | + | 2187 | WP_283921286.1 | Tex family protein | - |
QNH20_RS02030 (QNH20_02030) | 405149..405262 | - | 114 | WP_139311313.1 | cortex morphogenetic protein CmpA | - |
QNH20_RS02035 (QNH20_02035) | 405360..405833 | + | 474 | WP_283921287.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13006.03 Da Isoelectric Point: 4.8998
>T282639 WP_007083556.1 NZ_CP126110:402380-402730 [Neobacillus sp. WH10]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K6DRS5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1S2RGM2 |