Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 218042..218678 | Replicon | chromosome |
Accession | NZ_CP126109 | ||
Organism | Fictibacillus enclensis strain TL11 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | I8UKL4 |
Locus tag | QNH15_RS01250 | Protein ID | WP_007200228.1 |
Coordinates | 218328..218678 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A0V8IRQ4 |
Locus tag | QNH15_RS01245 | Protein ID | WP_061975875.1 |
Coordinates | 218042..218323 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH15_RS01220 (QNH15_01220) | 213565..214320 | + | 756 | WP_283891976.1 | STAS domain-containing protein | - |
QNH15_RS01225 (QNH15_01225) | 214363..214959 | - | 597 | WP_283891978.1 | rhomboid family intramembrane serine protease | - |
QNH15_RS01230 (QNH15_01230) | 215046..215402 | + | 357 | WP_283891979.1 | holo-ACP synthase | - |
QNH15_RS01235 (QNH15_01235) | 215546..216580 | + | 1035 | WP_283891980.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH15_RS01240 (QNH15_01240) | 216710..217897 | + | 1188 | WP_283891982.1 | alanine racemase | - |
QNH15_RS01245 (QNH15_01245) | 218042..218323 | + | 282 | WP_061975875.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
QNH15_RS01250 (QNH15_01250) | 218328..218678 | + | 351 | WP_007200228.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNH15_RS01255 (QNH15_01255) | 218849..219664 | + | 816 | WP_283891987.1 | STAS domain-containing protein | - |
QNH15_RS01260 (QNH15_01260) | 219677..220033 | + | 357 | WP_061975879.1 | STAS domain-containing protein | - |
QNH15_RS01265 (QNH15_01265) | 220036..220437 | + | 402 | WP_129478414.1 | anti-sigma regulatory factor | - |
QNH15_RS01270 (QNH15_01270) | 220448..221455 | + | 1008 | WP_283891992.1 | PP2C family protein-serine/threonine phosphatase | - |
QNH15_RS01275 (QNH15_01275) | 221517..221849 | + | 333 | WP_283891994.1 | STAS domain-containing protein | - |
QNH15_RS01280 (QNH15_01280) | 221846..222331 | + | 486 | WP_283891995.1 | anti-sigma B factor RsbW | - |
QNH15_RS01285 (QNH15_01285) | 222297..223088 | + | 792 | WP_283891997.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13060.17 Da Isoelectric Point: 6.4714
>T282638 WP_007200228.1 NZ_CP126109:218328-218678 [Fictibacillus enclensis]
MIVKRGDVYFADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMRRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGIRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMRRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V8IRG1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V8IRQ4 |