Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yxiD-yxxD/- |
| Location | 295517..296361 | Replicon | chromosome |
| Accession | NZ_CP126108 | ||
| Organism | Cytobacillus firmus strain SQ11 | ||
Toxin (Protein)
| Gene name | yxiD | Uniprot ID | - |
| Locus tag | QNH42_RS01650 | Protein ID | WP_283935295.1 |
| Coordinates | 295517..295915 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yxxD | Uniprot ID | - |
| Locus tag | QNH42_RS01655 | Protein ID | WP_226620340.1 |
| Coordinates | 295924..296361 (+) | Length | 146 a.a. |
Genomic Context
Location: 291361..291708 (348 bp)
Type: Others
Protein ID: WP_226620345.1
Type: Others
Protein ID: WP_226620345.1
Location: 294199..295536 (1338 bp)
Type: Others
Protein ID: WP_283935294.1
Type: Others
Protein ID: WP_283935294.1
Location: 295517..295915 (399 bp)
Type: Toxin
Protein ID: WP_283935295.1
Type: Toxin
Protein ID: WP_283935295.1
Location: 295924..296361 (438 bp)
Type: Antitoxin
Protein ID: WP_226620340.1
Type: Antitoxin
Protein ID: WP_226620340.1
Location: 296537..296737 (201 bp)
Type: Others
Protein ID: WP_076262170.1
Type: Others
Protein ID: WP_076262170.1
Location: 297029..298219 (1191 bp)
Type: Others
Protein ID: WP_197245259.1
Type: Others
Protein ID: WP_197245259.1
Location: 299065..300063 (999 bp)
Type: Others
Protein ID: WP_048010875.1
Type: Others
Protein ID: WP_048010875.1
Location: 300553..300846 (294 bp)
Type: Others
Protein ID: WP_009336200.1
Type: Others
Protein ID: WP_009336200.1
Location: 300926..301165 (240 bp)
Type: Others
Protein ID: WP_197245261.1
Type: Others
Protein ID: WP_197245261.1
Location: 291845..293029 (1185 bp)
Type: Others
Protein ID: WP_226620344.1
Type: Others
Protein ID: WP_226620344.1
Location: 293281..293568 (288 bp)
Type: Others
Protein ID: WP_226620343.1
Type: Others
Protein ID: WP_226620343.1
Location: 293582..293941 (360 bp)
Type: Others
Protein ID: WP_250801594.1
Type: Others
Protein ID: WP_250801594.1
Location: 298262..298885 (624 bp)
Type: Others
Protein ID: WP_048010876.1
Type: Others
Protein ID: WP_048010876.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH42_RS01625 (QNH42_01625) | 291361..291708 | + | 348 | WP_226620345.1 | glyoxalase | - |
| QNH42_RS01630 (QNH42_01630) | 291845..293029 | - | 1185 | WP_226620344.1 | DUF4317 domain-containing protein | - |
| QNH42_RS01635 (QNH42_01635) | 293281..293568 | - | 288 | WP_226620343.1 | YwqI/YxiC family protein | - |
| QNH42_RS01640 (QNH42_01640) | 293582..293941 | - | 360 | WP_250801594.1 | DUF5082 family protein | - |
| QNH42_RS01645 (QNH42_01645) | 294199..295536 | + | 1338 | WP_283935294.1 | LXG domain-containing protein | - |
| QNH42_RS01650 (QNH42_01650) | 295517..295915 | + | 399 | WP_283935295.1 | HNH endonuclease | Toxin |
| QNH42_RS01655 (QNH42_01655) | 295924..296361 | + | 438 | WP_226620340.1 | SMI1/KNR4 family protein | Antitoxin |
| QNH42_RS01660 (QNH42_01660) | 296537..296737 | + | 201 | WP_076262170.1 | hypothetical protein | - |
| QNH42_RS01665 (QNH42_01665) | 297029..298219 | + | 1191 | WP_197245259.1 | M14 family zinc carboxypeptidase | - |
| QNH42_RS01670 (QNH42_01670) | 298262..298885 | - | 624 | WP_048010876.1 | DUF421 domain-containing protein | - |
| QNH42_RS01675 (QNH42_01675) | 299065..300063 | + | 999 | WP_048010875.1 | ABC transporter substrate-binding protein | - |
| QNH42_RS01680 (QNH42_01680) | 300553..300846 | + | 294 | WP_009336200.1 | WXG100 family type VII secretion target | - |
| QNH42_RS01685 (QNH42_01685) | 300926..301165 | + | 240 | WP_197245261.1 | EsaB/YukD family protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15451.36 Da Isoelectric Point: 10.0026
>T282637 WP_283935295.1 NZ_CP126108:295517-295915 [Cytobacillus firmus]
MRDIEAKTGRKVNKEQIDLIKEDLRNKNYEKLTPRETAKHRSKFTSSLKDKLIAEWEEKTNQKWPRYTEEVLDKNGEVAR
SIGQPYDAHHIIENNFGGPHEWWNIHPAKYPNEHQAGIHGKGAPSGKLFPRR
MRDIEAKTGRKVNKEQIDLIKEDLRNKNYEKLTPRETAKHRSKFTSSLKDKLIAEWEEKTNQKWPRYTEEVLDKNGEVAR
SIGQPYDAHHIIENNFGGPHEWWNIHPAKYPNEHQAGIHGKGAPSGKLFPRR
Download Length: 399 bp
Antitoxin
Download Length: 146 a.a. Molecular weight: 16884.90 Da Isoelectric Point: 3.7177
>AT282637 WP_226620340.1 NZ_CP126108:295924-296361 [Cytobacillus firmus]
MADFEFINELENKLYKVTNDDILKAEQRMDISLPNDLKQLYLEVGYGFIEGLSANSINRILGPGAVADIRLREGVFEFDP
DLDELFDDEDKLIFFEVNEGVYISIDLQLANNPIFYFDTQIAESLEDFFKKFLNNNEYFIDLIED
MADFEFINELENKLYKVTNDDILKAEQRMDISLPNDLKQLYLEVGYGFIEGLSANSINRILGPGAVADIRLREGVFEFDP
DLDELFDDEDKLIFFEVNEGVYISIDLQLANNPIFYFDTQIAESLEDFFKKFLNNNEYFIDLIED
Download Length: 438 bp