Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 254011..254647 | Replicon | chromosome |
Accession | NZ_CP126108 | ||
Organism | Cytobacillus firmus strain SQ11 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | W7KPR3 |
Locus tag | QNH42_RS01385 | Protein ID | WP_009336311.1 |
Coordinates | 254297..254647 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | W7L1R3 |
Locus tag | QNH42_RS01380 | Protein ID | WP_035331931.1 |
Coordinates | 254011..254292 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH42_RS01360 (QNH42_01360) | 249562..250287 | - | 726 | WP_163144744.1 | rhomboid family intramembrane serine protease | - |
QNH42_RS01365 (QNH42_01365) | 250443..250796 | + | 354 | WP_048008767.1 | holo-ACP synthase | - |
QNH42_RS01370 (QNH42_01370) | 250941..251954 | + | 1014 | WP_283935291.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH42_RS01375 (QNH42_01375) | 252389..253543 | + | 1155 | WP_226620280.1 | alanine racemase | - |
QNH42_RS01380 (QNH42_01380) | 254011..254292 | + | 282 | WP_035331931.1 | YlcI/YnfO family protein | Antitoxin |
QNH42_RS01385 (QNH42_01385) | 254297..254647 | + | 351 | WP_009336311.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNH42_RS01390 (QNH42_01390) | 255021..255854 | + | 834 | WP_163144748.1 | RsbT co-antagonist protein RsbRA | - |
QNH42_RS01395 (QNH42_01395) | 255851..256213 | + | 363 | WP_009336309.1 | STAS domain-containing protein | - |
QNH42_RS01400 (QNH42_01400) | 256218..256619 | + | 402 | WP_048008772.1 | anti-sigma regulatory factor | - |
QNH42_RS01405 (QNH42_01405) | 256631..257641 | + | 1011 | WP_048008773.1 | PP2C family protein-serine/threonine phosphatase | - |
QNH42_RS01410 (QNH42_01410) | 257702..258034 | + | 333 | WP_035331808.1 | anti-sigma factor antagonist | - |
QNH42_RS01415 (QNH42_01415) | 258031..258504 | + | 474 | WP_009336304.1 | anti-sigma B factor RsbW | - |
QNH42_RS01420 (QNH42_01420) | 258482..259276 | + | 795 | WP_048008774.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13006.03 Da Isoelectric Point: 4.8998
>T282636 WP_009336311.1 NZ_CP126108:254297-254647 [Cytobacillus firmus]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEAVQISLGLIEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEAVQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A169FD46 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W7L1R3 |