Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1256708..1257625 | Replicon | chromosome |
Accession | NZ_CP126104 | ||
Organism | Bacillus velezensis strain MB7_B11 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QNH19_RS06570 | Protein ID | WP_015239694.1 |
Coordinates | 1256879..1257625 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | QNH19_RS06565 | Protein ID | WP_003154807.1 |
Coordinates | 1256708..1256878 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH19_RS06530 (QNH19_06530) | 1251933..1253564 | + | 1632 | WP_283888200.1 | pyocin knob domain-containing protein | - |
QNH19_RS06535 (QNH19_06535) | 1253577..1253948 | + | 372 | WP_043021266.1 | XkdW family protein | - |
QNH19_RS06540 (QNH19_06540) | 1253953..1254150 | + | 198 | WP_007610833.1 | XkdX family protein | - |
QNH19_RS06545 (QNH19_06545) | 1254207..1254968 | + | 762 | WP_076423976.1 | phage portal protein | - |
QNH19_RS06550 (QNH19_06550) | 1255020..1255283 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
QNH19_RS06555 (QNH19_06555) | 1255297..1255560 | + | 264 | WP_003154813.1 | phage holin | - |
QNH19_RS06560 (QNH19_06560) | 1255574..1256452 | + | 879 | WP_129004094.1 | N-acetylmuramoyl-L-alanine amidase | - |
QNH19_RS06565 (QNH19_06565) | 1256708..1256878 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QNH19_RS06570 (QNH19_06570) | 1256879..1257625 | - | 747 | WP_015239694.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
QNH19_RS06575 (QNH19_06575) | 1257730..1258728 | - | 999 | WP_007407255.1 | inorganic phosphate transporter | - |
QNH19_RS06580 (QNH19_06580) | 1258741..1259358 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
QNH19_RS06585 (QNH19_06585) | 1259644..1260960 | - | 1317 | WP_007610842.1 | amino acid permease | - |
QNH19_RS06590 (QNH19_06590) | 1261283..1262233 | + | 951 | WP_012117369.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1223162..1265889 | 42727 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29135.61 Da Isoelectric Point: 4.7003
>T282631 WP_015239694.1 NZ_CP126104:c1257625-1256879 [Bacillus velezensis]
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAEWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAEWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|