Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 479716..480353 | Replicon | chromosome |
| Accession | NZ_CP126104 | ||
| Organism | Bacillus velezensis strain MB7_B11 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | QNH19_RS02450 | Protein ID | WP_003156187.1 |
| Coordinates | 480003..480353 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | QNH19_RS02445 | Protein ID | WP_003156188.1 |
| Coordinates | 479716..479997 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH19_RS02425 (QNH19_02425) | 476081..476680 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
| QNH19_RS02430 (QNH19_02430) | 476773..477138 | + | 366 | WP_007410229.1 | holo-ACP synthase | - |
| QNH19_RS02435 (QNH19_02435) | 477303..478310 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
| QNH19_RS02440 (QNH19_02440) | 478427..479596 | + | 1170 | WP_025284272.1 | alanine racemase | - |
| QNH19_RS02445 (QNH19_02445) | 479716..479997 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| QNH19_RS02450 (QNH19_02450) | 480003..480353 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QNH19_RS02455 (QNH19_02455) | 480471..481292 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| QNH19_RS02460 (QNH19_02460) | 481297..481662 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| QNH19_RS02465 (QNH19_02465) | 481665..482066 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| QNH19_RS02470 (QNH19_02470) | 482078..483085 | + | 1008 | WP_007410233.1 | PP2C family protein-serine/threonine phosphatase | - |
| QNH19_RS02475 (QNH19_02475) | 483149..483478 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| QNH19_RS02480 (QNH19_02480) | 483475..483957 | + | 483 | WP_007609591.1 | anti-sigma B factor RsbW | - |
| QNH19_RS02485 (QNH19_02485) | 483923..484711 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
| QNH19_RS02490 (QNH19_02490) | 484711..485313 | + | 603 | WP_283887783.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T282630 WP_003156187.1 NZ_CP126104:480003-480353 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|