Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1371268..1372184 | Replicon | chromosome |
Accession | NZ_CP126100 | ||
Organism | Bacillus halotolerans strain LN2 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | A0A7G7U9Y2 |
Locus tag | QNH41_RS07095 | Protein ID | WP_024121091.1 |
Coordinates | 1371438..1372184 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | A0A7G7U9Y3 |
Locus tag | QNH41_RS07090 | Protein ID | WP_024121090.1 |
Coordinates | 1371268..1371438 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH41_RS07055 (1368131) | 1368131..1368460 | + | 330 | WP_283912936.1 | XkdW family protein | - |
QNH41_RS07060 (1368457) | 1368457..1368621 | + | 165 | WP_185848046.1 | XkdX family protein | - |
QNH41_RS07065 (1368665) | 1368665..1369504 | + | 840 | WP_283912937.1 | phage portal protein | - |
QNH41_RS07070 (1369560) | 1369560..1369829 | + | 270 | WP_024121085.1 | hemolysin XhlA family protein | - |
QNH41_RS07075 (1369841) | 1369841..1370104 | + | 264 | WP_024121086.1 | phage holin | - |
QNH41_RS07080 (1370117) | 1370117..1371010 | + | 894 | WP_283912938.1 | N-acetylmuramoyl-L-alanine amidase | - |
QNH41_RS07085 (1371047) | 1371047..1371184 | - | 138 | WP_125825426.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
QNH41_RS07090 (1371268) | 1371268..1371438 | - | 171 | WP_024121090.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
QNH41_RS07095 (1371438) | 1371438..1372184 | - | 747 | WP_024121091.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
QNH41_RS07100 (1372293) | 1372293..1373294 | - | 1002 | WP_024121092.1 | inorganic phosphate transporter | - |
QNH41_RS07105 (1373307) | 1373307..1373924 | - | 618 | WP_010333926.1 | DUF47 domain-containing protein | - |
QNH41_RS07110 (1374201) | 1374201..1375517 | - | 1317 | WP_099042852.1 | serine/threonine exchanger | - |
QNH41_RS07115 (1375912) | 1375912..1376862 | + | 951 | WP_127695396.1 | ring-cleaving dioxygenase | - |
QNH41_RS07120 (1377022) | 1377022..1377102 | + | 81 | Protein_1339 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1336547..1380625 | 44078 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29076.48 Da Isoelectric Point: 4.4986
>T282619 WP_024121091.1 NZ_CP126100:c1372184-1371438 [Bacillus halotolerans]
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MLLFFQIMVWCTMAALGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMIYWTYDPSSLFTNWERYVIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLDRLKTYQYLLKNEPIHVYYGSIEAYAEGIDKLLKTYADKMNLTASL
CHYSTQSDKDRLTEHMEDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQSYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G7U9Y2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7G7U9Y3 |