Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 520938..521574 | Replicon | chromosome |
Accession | NZ_CP126100 | ||
Organism | Bacillus halotolerans strain LN2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QNH41_RS02650 | Protein ID | WP_003156187.1 |
Coordinates | 521224..521574 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QNH41_RS02645 | Protein ID | WP_003225183.1 |
Coordinates | 520938..521219 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH41_RS02625 (517293) | 517293..517892 | - | 600 | WP_024120294.1 | rhomboid family intramembrane serine protease | - |
QNH41_RS02630 (517987) | 517987..518352 | + | 366 | WP_106020948.1 | holo-ACP synthase | - |
QNH41_RS02635 (518518) | 518518..519534 | + | 1017 | WP_081638241.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH41_RS02640 (519651) | 519651..520820 | + | 1170 | WP_024120297.1 | alanine racemase | - |
QNH41_RS02645 (520938) | 520938..521219 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QNH41_RS02650 (521224) | 521224..521574 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNH41_RS02655 (521690) | 521690..522514 | + | 825 | WP_283912799.1 | RsbT co-antagonist protein RsbRA | - |
QNH41_RS02660 (522519) | 522519..522884 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QNH41_RS02665 (522887) | 522887..523288 | + | 402 | WP_106020946.1 | serine/threonine-protein kinase RsbT | - |
QNH41_RS02670 (523300) | 523300..524307 | + | 1008 | WP_024120300.1 | phosphoserine phosphatase RsbU | - |
QNH41_RS02675 (524368) | 524368..524697 | + | 330 | WP_024120301.1 | anti-sigma factor antagonist RsbV | - |
QNH41_RS02680 (524694) | 524694..525176 | + | 483 | WP_024120302.1 | anti-sigma B factor RsbW | - |
QNH41_RS02685 (525142) | 525142..525930 | + | 789 | WP_024120303.1 | RNA polymerase sigma factor SigB | - |
QNH41_RS02690 (525930) | 525930..526529 | + | 600 | WP_024120304.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T282618 WP_003156187.1 NZ_CP126100:521224-521574 [Bacillus halotolerans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|