Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 239794..240436 | Replicon | chromosome |
Accession | NZ_CP126099 | ||
Organism | Bacillus wiedmannii strain LN15 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | J8CWW5 |
Locus tag | QNH45_RS01345 | Protein ID | WP_000635963.1 |
Coordinates | 240086..240436 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | R8I8H2 |
Locus tag | QNH45_RS01340 | Protein ID | WP_000004570.1 |
Coordinates | 239794..240081 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH45_RS01315 (QNH45_01315) | 235007..235969 | + | 963 | WP_283883842.1 | UV DNA damage repair endonuclease UvsE | - |
QNH45_RS01320 (QNH45_01320) | 236089..236637 | - | 549 | WP_283883844.1 | rhomboid family intramembrane serine protease | - |
QNH45_RS01325 (QNH45_01325) | 236730..237089 | + | 360 | WP_283883846.1 | holo-ACP synthase | - |
QNH45_RS01330 (QNH45_01330) | 237246..238196 | + | 951 | WP_283886254.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH45_RS01335 (QNH45_01335) | 238315..239484 | + | 1170 | WP_283883848.1 | alanine racemase | - |
QNH45_RS01340 (QNH45_01340) | 239794..240081 | + | 288 | WP_000004570.1 | antitoxin EndoAI | Antitoxin |
QNH45_RS01345 (QNH45_01345) | 240086..240436 | + | 351 | WP_000635963.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNH45_RS01350 (QNH45_01350) | 240505..242673 | + | 2169 | WP_000426248.1 | Tex family protein | - |
QNH45_RS01355 (QNH45_01355) | 242731..242847 | - | 117 | WP_001143642.1 | cortex morphogenetic protein CmpA | - |
QNH45_RS01360 (QNH45_01360) | 243037..243501 | + | 465 | WP_283883850.1 | SprT family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12974.12 Da Isoelectric Point: 5.7168
>T282616 WP_000635963.1 NZ_CP126099:240086-240436 [Bacillus wiedmannii]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEVMMIRVDEALQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 4HKE | |
PDB | 7BXY |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A366FY90 |