Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1320178..1321094 | Replicon | chromosome |
Accession | NZ_CP126097 | ||
Organism | Bacillus subtilis strain KF24 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | QNK06_RS07015 | Protein ID | WP_220396471.1 |
Coordinates | 1320348..1321094 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | QNK06_RS07010 | Protein ID | WP_003232646.1 |
Coordinates | 1320178..1320348 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNK06_RS06970 (1315892) | 1315892..1316221 | + | 330 | WP_283934290.1 | XkdW family protein | - |
QNK06_RS06975 (1316218) | 1316218..1316382 | + | 165 | WP_181217004.1 | XkdX family protein | - |
QNK06_RS06980 (1316429) | 1316429..1317268 | + | 840 | WP_283934291.1 | phage-like element PBSX protein XepA | - |
QNK06_RS06985 (1317321) | 1317321..1317590 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
QNK06_RS06990 (1317603) | 1317603..1317866 | + | 264 | WP_014479566.1 | phage holin | - |
QNK06_RS06995 (1317879) | 1317879..1318775 | + | 897 | WP_181217006.1 | N-acetylmuramoyl-L-alanine amidase | - |
QNK06_RS07000 (1318852) | 1318852..1319943 | + | 1092 | WP_181217007.1 | acyltransferase family protein | - |
QNK06_RS07005 (1319940) | 1319940..1320092 | - | 153 | WP_131228329.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
QNK06_RS07010 (1320178) | 1320178..1320348 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
QNK06_RS07015 (1320348) | 1320348..1321094 | - | 747 | WP_220396471.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
QNK06_RS07020 (1321204) | 1321204..1322205 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
QNK06_RS07025 (1322218) | 1322218..1322835 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
QNK06_RS07030 (1323111) | 1323111..1324427 | - | 1317 | WP_085186195.1 | serine/threonine exchanger | - |
QNK06_RS07035 (1324816) | 1324816..1325766 | + | 951 | WP_015252261.1 | ring-cleaving dioxygenase | - |
QNK06_RS07040 (1325875) | 1325875..1325970 | + | 96 | Protein_1326 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29003.46 Da Isoelectric Point: 4.6878
>T282608 WP_220396471.1 NZ_CP126097:c1321094-1320348 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDGPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDGPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|