Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 509240..509876 | Replicon | chromosome |
Accession | NZ_CP126097 | ||
Organism | Bacillus subtilis strain KF24 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QNK06_RS02610 | Protein ID | WP_003156187.1 |
Coordinates | 509526..509876 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QNK06_RS02605 | Protein ID | WP_003225183.1 |
Coordinates | 509240..509521 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNK06_RS02585 (505599) | 505599..506198 | - | 600 | WP_219144775.1 | rhomboid family intramembrane serine protease | - |
QNK06_RS02590 (506293) | 506293..506658 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
QNK06_RS02595 (506824) | 506824..507840 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
QNK06_RS02600 (507955) | 507955..509124 | + | 1170 | WP_219144776.1 | alanine racemase | - |
QNK06_RS02605 (509240) | 509240..509521 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QNK06_RS02610 (509526) | 509526..509876 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNK06_RS02615 (509992) | 509992..510816 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
QNK06_RS02620 (510821) | 510821..511186 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QNK06_RS02625 (511190) | 511190..511591 | + | 402 | WP_003225192.1 | serine/threonine-protein kinase RsbT | - |
QNK06_RS02630 (511603) | 511603..512610 | + | 1008 | WP_014478900.1 | phosphoserine phosphatase RsbU | - |
QNK06_RS02635 (512679) | 512679..513008 | + | 330 | WP_014475877.1 | anti-sigma factor antagonist RsbV | - |
QNK06_RS02640 (513005) | 513005..513487 | + | 483 | WP_283934068.1 | anti-sigma B factor RsbW | - |
QNK06_RS02645 (513453) | 513453..514241 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
QNK06_RS02650 (514241) | 514241..514840 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T282607 WP_003156187.1 NZ_CP126097:509526-509876 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|