Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 547878..548514 | Replicon | chromosome |
Accession | NZ_CP126096 | ||
Organism | Bacillus altitudinis strain G6S2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K2MHT4 |
Locus tag | QNH34_RS02630 | Protein ID | WP_003214169.1 |
Coordinates | 548164..548514 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | QNH34_RS02625 | Protein ID | WP_003214273.1 |
Coordinates | 547878..548159 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH34_RS02605 (QNH34_02605) | 544024..544629 | - | 606 | WP_007496491.1 | rhomboid family intramembrane serine protease | - |
QNH34_RS02610 (QNH34_02610) | 544724..545089 | + | 366 | WP_283933323.1 | holo-ACP synthase | - |
QNH34_RS02615 (QNH34_02615) | 545250..546266 | + | 1017 | WP_007496489.1 | outer membrane lipoprotein-sorting protein | - |
QNH34_RS02620 (QNH34_02620) | 546402..547583 | + | 1182 | WP_061418044.1 | alanine racemase | - |
QNH34_RS02625 (QNH34_02625) | 547878..548159 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
QNH34_RS02630 (QNH34_02630) | 548164..548514 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNH34_RS02635 (QNH34_02635) | 548629..549459 | + | 831 | WP_017358395.1 | RsbT co-antagonist protein RsbRA | - |
QNH34_RS02640 (QNH34_02640) | 549464..549832 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
QNH34_RS02645 (QNH34_02645) | 549835..550236 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
QNH34_RS02650 (QNH34_02650) | 550247..551254 | + | 1008 | WP_017358394.1 | PP2C family protein-serine/threonine phosphatase | - |
QNH34_RS02655 (QNH34_02655) | 551314..551643 | + | 330 | WP_017358393.1 | anti-sigma factor antagonist | - |
QNH34_RS02660 (QNH34_02660) | 551640..552128 | + | 489 | WP_178929502.1 | anti-sigma B factor RsbW | - |
QNH34_RS02665 (QNH34_02665) | 552094..552882 | + | 789 | WP_012009000.1 | RNA polymerase sigma factor SigB | - |
QNH34_RS02670 (QNH34_02670) | 552882..553481 | + | 600 | WP_024719202.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T282606 WP_003214169.1 NZ_CP126096:548164-548514 [Bacillus altitudinis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K2MHT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |