Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 1285312..1285947 | Replicon | chromosome |
| Accession | NZ_CP126095 | ||
| Organism | Paenibacillus sp. G2S3 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0W1B4L6 |
| Locus tag | QNH28_RS05655 | Protein ID | WP_042124727.1 |
| Coordinates | 1285597..1285947 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A089IDM2 |
| Locus tag | QNH28_RS05650 | Protein ID | WP_025698676.1 |
| Coordinates | 1285312..1285593 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH28_RS05630 (QNH28_05630) | 1280755..1282146 | + | 1392 | WP_283910529.1 | helix-turn-helix transcriptional regulator | - |
| QNH28_RS05635 (QNH28_05635) | 1282233..1282406 | + | 174 | WP_283910530.1 | aspartyl-phosphate phosphatase Spo0E family protein | - |
| QNH28_RS05640 (QNH28_05640) | 1282641..1283726 | + | 1086 | WP_094872533.1 | outer membrane lipoprotein carrier protein LolA | - |
| QNH28_RS05645 (QNH28_05645) | 1283916..1285097 | + | 1182 | WP_283910531.1 | alanine racemase | - |
| QNH28_RS05650 (QNH28_05650) | 1285312..1285593 | + | 282 | WP_025698676.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| QNH28_RS05655 (QNH28_05655) | 1285597..1285947 | + | 351 | WP_042124727.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QNH28_RS05660 (QNH28_05660) | 1286104..1286712 | + | 609 | WP_283910532.1 | TetR/AcrR family transcriptional regulator | - |
| QNH28_RS05665 (QNH28_05665) | 1286893..1288092 | + | 1200 | WP_283910533.1 | MFS transporter | - |
| QNH28_RS05670 (QNH28_05670) | 1288212..1290440 | + | 2229 | WP_283910534.1 | Tex family protein | - |
| QNH28_RS05675 (QNH28_05675) | 1290530..1290682 | - | 153 | WP_283910535.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12764.68 Da Isoelectric Point: 5.1171
>T282605 WP_042124727.1 NZ_CP126095:1285597-1285947 [Paenibacillus sp. G2S3]
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQV
RTIDKQRLTDKITHLDDETMKKVDDSLQISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAAAHGFDRDSVILLEQV
RTIDKQRLTDKITHLDDETMKKVDDSLQISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0W1B4L6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A089IDM2 |