Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1316734..1317650 | Replicon | chromosome |
| Accession | NZ_CP126094 | ||
| Organism | Bacillus subtilis strain G2S2 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | QNH31_RS06895 | Protein ID | WP_003244695.1 |
| Coordinates | 1316904..1317650 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | QNH31_RS06890 | Protein ID | WP_003232646.1 |
| Coordinates | 1316734..1316904 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH31_RS06855 (QNH31_06855) | 1313597..1313926 | + | 330 | WP_041850928.1 | XkdW family protein | - |
| QNH31_RS06860 (QNH31_06860) | 1313923..1314087 | + | 165 | WP_041850927.1 | XkdX family protein | - |
| QNH31_RS06865 (QNH31_06865) | 1314131..1314970 | + | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
| QNH31_RS06870 (QNH31_06870) | 1315023..1315292 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| QNH31_RS06875 (QNH31_06875) | 1315305..1315568 | + | 264 | WP_003232653.1 | phage holin | - |
| QNH31_RS06880 (QNH31_06880) | 1315581..1316474 | + | 894 | WP_041850925.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QNH31_RS06885 (QNH31_06885) | 1316511..1316648 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| QNH31_RS06890 (QNH31_06890) | 1316734..1316904 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| QNH31_RS06895 (QNH31_06895) | 1316904..1317650 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| QNH31_RS06900 (QNH31_06900) | 1317760..1318761 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| QNH31_RS06905 (QNH31_06905) | 1318774..1319391 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| QNH31_RS06910 (QNH31_06910) | 1319667..1320983 | - | 1317 | WP_041850924.1 | serine/threonine exchanger | - |
| QNH31_RS06915 (QNH31_06915) | 1321371..1322321 | + | 951 | WP_041344800.1 | ring-cleaving dioxygenase | - |
| QNH31_RS06920 (QNH31_06920) | 1322422..1322568 | + | 147 | WP_120363335.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1282861..1325727 | 42866 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T282604 WP_003244695.1 NZ_CP126094:c1317650-1316904 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|