Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 512276..512912 | Replicon | chromosome |
Accession | NZ_CP126094 | ||
Organism | Bacillus subtilis strain G2S2 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QNH31_RS02620 | Protein ID | WP_003156187.1 |
Coordinates | 512562..512912 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QNH31_RS02615 | Protein ID | WP_003225183.1 |
Coordinates | 512276..512557 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH31_RS02595 (QNH31_02595) | 508636..509235 | - | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
QNH31_RS02600 (QNH31_02600) | 509330..509695 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
QNH31_RS02605 (QNH31_02605) | 509861..510877 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH31_RS02610 (QNH31_02610) | 510991..512160 | + | 1170 | WP_015252766.1 | alanine racemase | - |
QNH31_RS02615 (QNH31_02615) | 512276..512557 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QNH31_RS02620 (QNH31_02620) | 512562..512912 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNH31_RS02625 (QNH31_02625) | 513027..513851 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
QNH31_RS02630 (QNH31_02630) | 513856..514221 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QNH31_RS02635 (QNH31_02635) | 514225..514626 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
QNH31_RS02640 (QNH31_02640) | 514638..515645 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
QNH31_RS02645 (QNH31_02645) | 515707..516036 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
QNH31_RS02650 (QNH31_02650) | 516033..516515 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
QNH31_RS02655 (QNH31_02655) | 516481..517269 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
QNH31_RS02660 (QNH31_02660) | 517269..517868 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T282603 WP_003156187.1 NZ_CP126094:512562-512912 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|