Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | pemIK/MazF(toxin) |
Location | 280510..281149 | Replicon | chromosome |
Accession | NZ_CP126092 | ||
Organism | Peribacillus simplex strain D9_B_73 |
Toxin (Protein)
Gene name | pemK | Uniprot ID | - |
Locus tag | QNH50_RS01470 | Protein ID | WP_034306610.1 |
Coordinates | 280799..281149 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | QNH50_RS01465 | Protein ID | WP_034306380.1 |
Coordinates | 280510..280791 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH50_RS01445 (QNH50_01445) | 276644..277234 | - | 591 | WP_230302699.1 | rhomboid family intramembrane serine protease | - |
QNH50_RS01450 (QNH50_01450) | 277343..277693 | + | 351 | WP_053537119.1 | holo-ACP synthase | - |
QNH50_RS01455 (QNH50_01455) | 277938..278942 | + | 1005 | WP_230302698.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH50_RS01460 (QNH50_01460) | 279165..280349 | + | 1185 | WP_230302697.1 | alanine racemase | - |
QNH50_RS01465 (QNH50_01465) | 280510..280791 | + | 282 | WP_034306380.1 | antitoxin EndoAI | Antitoxin |
QNH50_RS01470 (QNH50_01470) | 280799..281149 | + | 351 | WP_034306610.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QNH50_RS01475 (QNH50_01475) | 281563..282390 | + | 828 | WP_230302696.1 | RsbT co-antagonist protein RsbRA | - |
QNH50_RS01480 (QNH50_01480) | 282393..282749 | + | 357 | WP_230302695.1 | STAS domain-containing protein | - |
QNH50_RS01485 (QNH50_01485) | 282753..283154 | + | 402 | WP_214774177.1 | anti-sigma regulatory factor | - |
QNH50_RS01490 (QNH50_01490) | 283164..284174 | + | 1011 | WP_230302694.1 | PP2C family protein-serine/threonine phosphatase | - |
QNH50_RS01495 (QNH50_01495) | 284234..284566 | + | 333 | WP_098372176.1 | anti-sigma factor antagonist | - |
QNH50_RS01500 (QNH50_01500) | 284563..285036 | + | 474 | WP_098372177.1 | anti-sigma B factor RsbW | - |
QNH50_RS01505 (QNH50_01505) | 285014..285802 | + | 789 | WP_230302693.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12955.06 Da Isoelectric Point: 7.2029
>T282601 WP_034306610.1 NZ_CP126092:280799-281149 [Peribacillus simplex]
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
IVVKRGDVYFADLSPVVGSEQGGTRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDEPMMQKVNEALQISLGLIEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|