Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 571443..572079 | Replicon | chromosome |
| Accession | NZ_CP126091 | ||
| Organism | Bacillus paralicheniformis strain CEW 1W | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | M5P3Q9 |
| Locus tag | QNH18_RS02850 | Protein ID | WP_003179128.1 |
| Coordinates | 571729..572079 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | M5PDU2 |
| Locus tag | QNH18_RS02845 | Protein ID | WP_006638778.1 |
| Coordinates | 571443..571724 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH18_RS02825 (QNH18_02825) | 566554..568038 | + | 1485 | WP_023857868.1 | PH domain-containing protein | - |
| QNH18_RS02830 (QNH18_02830) | 568035..568634 | - | 600 | WP_023857867.1 | rhomboid family intramembrane serine protease | - |
| QNH18_RS02835 (QNH18_02835) | 568978..569937 | + | 960 | WP_164468292.1 | outer membrane lipoprotein carrier protein LolA | - |
| QNH18_RS02840 (QNH18_02840) | 570162..571331 | + | 1170 | WP_219192348.1 | alanine racemase | - |
| QNH18_RS02845 (QNH18_02845) | 571443..571724 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
| QNH18_RS02850 (QNH18_02850) | 571729..572079 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QNH18_RS02855 (QNH18_02855) | 572197..573024 | + | 828 | WP_023857863.1 | RsbT co-antagonist protein RsbRA | - |
| QNH18_RS02860 (QNH18_02860) | 573028..573393 | + | 366 | WP_031305225.1 | STAS domain-containing protein | - |
| QNH18_RS02865 (QNH18_02865) | 573396..573797 | + | 402 | WP_023857861.1 | anti-sigma regulatory factor | - |
| QNH18_RS02870 (QNH18_02870) | 573808..574815 | + | 1008 | WP_020450261.1 | PP2C family protein-serine/threonine phosphatase | - |
| QNH18_RS02875 (QNH18_02875) | 574874..575200 | + | 327 | WP_020450262.1 | anti-sigma factor antagonist | - |
| QNH18_RS02880 (QNH18_02880) | 575200..575682 | + | 483 | WP_020450263.1 | anti-sigma B factor RsbW | - |
| QNH18_RS02885 (QNH18_02885) | 575648..576439 | + | 792 | WP_023857858.1 | RNA polymerase sigma factor SigB | - |
| QNH18_RS02890 (QNH18_02890) | 576436..577035 | + | 600 | WP_035337155.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T282599 WP_003179128.1 NZ_CP126091:571729-572079 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6I7FHI4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M5PDU2 |