Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 530839..531475 | Replicon | chromosome |
| Accession | NZ_CP126090 | ||
| Organism | Bacillus safensis strain CEW AP102 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0P7G713 |
| Locus tag | QNH21_RS02560 | Protein ID | WP_024425388.1 |
| Coordinates | 531125..531475 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | W8QJ31 |
| Locus tag | QNH21_RS02555 | Protein ID | WP_003214273.1 |
| Coordinates | 530839..531120 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH21_RS02535 (QNH21_02535) | 526979..527584 | - | 606 | WP_024425384.1 | rhomboid family intramembrane serine protease | - |
| QNH21_RS02540 (QNH21_02540) | 527679..528044 | + | 366 | WP_047202005.1 | holo-ACP synthase | - |
| QNH21_RS02545 (QNH21_02545) | 528205..529221 | + | 1017 | WP_087975235.1 | outer membrane lipoprotein-sorting protein | - |
| QNH21_RS02550 (QNH21_02550) | 529363..530544 | + | 1182 | WP_044334720.1 | alanine racemase | - |
| QNH21_RS02555 (QNH21_02555) | 530839..531120 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
| QNH21_RS02560 (QNH21_02560) | 531125..531475 | + | 351 | WP_024425388.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| QNH21_RS02565 (QNH21_02565) | 531592..532422 | + | 831 | WP_044334717.1 | RsbT co-antagonist protein RsbRA | - |
| QNH21_RS02570 (QNH21_02570) | 532427..532795 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
| QNH21_RS02575 (QNH21_02575) | 532798..533199 | + | 402 | WP_073203956.1 | anti-sigma regulatory factor | - |
| QNH21_RS02580 (QNH21_02580) | 533210..534217 | + | 1008 | WP_024425391.1 | PP2C family protein-serine/threonine phosphatase | - |
| QNH21_RS02585 (QNH21_02585) | 534277..534606 | + | 330 | WP_024425392.1 | anti-sigma factor antagonist | - |
| QNH21_RS02590 (QNH21_02590) | 534603..535091 | + | 489 | WP_024425393.1 | anti-sigma B factor RsbW | - |
| QNH21_RS02595 (QNH21_02595) | 535057..535845 | + | 789 | WP_024425394.1 | RNA polymerase sigma factor SigB | - |
| QNH21_RS02600 (QNH21_02600) | 535845..536444 | + | 600 | WP_024425395.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8891
>T282598 WP_024425388.1 NZ_CP126090:531125-531475 [Bacillus safensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7G713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A081L854 |