Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 207966..208602 | Replicon | chromosome |
Accession | NZ_CP126088 | ||
Organism | Priestia flexa strain CCW CN82 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0V8JQ27 |
Locus tag | QNH32_RS01140 | Protein ID | WP_025910606.1 |
Coordinates | 208252..208602 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | A0A1N6ZQI9 |
Locus tag | QNH32_RS01135 | Protein ID | WP_025910605.1 |
Coordinates | 207966..208247 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH32_RS01110 (QNH32_01110) | 203240..204208 | + | 969 | WP_239429273.1 | UV DNA damage repair endonuclease UvsE | - |
QNH32_RS01115 (QNH32_01115) | 204244..204837 | - | 594 | WP_283880482.1 | rhomboid family intramembrane serine protease | - |
QNH32_RS01120 (QNH32_01120) | 204929..205297 | + | 369 | WP_025910601.1 | holo-ACP synthase | - |
QNH32_RS01125 (QNH32_01125) | 205411..206427 | + | 1017 | WP_025910603.1 | outer membrane lipoprotein carrier protein LolA | - |
QNH32_RS01130 (QNH32_01130) | 206616..207788 | + | 1173 | WP_061785870.1 | alanine racemase | - |
QNH32_RS01135 (QNH32_01135) | 207966..208247 | + | 282 | WP_025910605.1 | hypothetical protein | Antitoxin |
QNH32_RS01140 (QNH32_01140) | 208252..208602 | + | 351 | WP_025910606.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
QNH32_RS01145 (QNH32_01145) | 208776..209612 | + | 837 | WP_061785869.1 | RsbT co-antagonist protein RsbRA | - |
QNH32_RS01150 (QNH32_01150) | 209609..209971 | + | 363 | WP_035321022.1 | STAS domain-containing protein | - |
QNH32_RS01155 (QNH32_01155) | 209975..210376 | + | 402 | WP_025910609.1 | anti-sigma regulatory factor | - |
QNH32_RS01160 (QNH32_01160) | 210388..211401 | + | 1014 | WP_061785868.1 | PP2C family protein-serine/threonine phosphatase | - |
QNH32_RS01165 (QNH32_01165) | 211464..211796 | + | 333 | WP_061785867.1 | anti-sigma factor antagonist | - |
QNH32_RS01170 (QNH32_01170) | 211793..212278 | + | 486 | WP_163070556.1 | anti-sigma B factor RsbW | - |
QNH32_RS01175 (QNH32_01175) | 212244..213038 | + | 795 | WP_163070555.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.94 Da Isoelectric Point: 5.1442
>T282596 WP_025910606.1 NZ_CP126088:208252-208602 [Priestia flexa]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDDALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDDALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0V8JQ27 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1N6ZQI9 |