Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 546453..547089 | Replicon | chromosome |
Accession | NZ_CP126086 | ||
Organism | Bacillus altitudinis strain CES-OCA-19 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K2MHT4 |
Locus tag | QNH40_RS02640 | Protein ID | WP_003214169.1 |
Coordinates | 546739..547089 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | W8QJ31 |
Locus tag | QNH40_RS02635 | Protein ID | WP_003214273.1 |
Coordinates | 546453..546734 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNH40_RS02615 (QNH40_02615) | 542610..543212 | - | 603 | WP_283931231.1 | rhomboid family intramembrane serine protease | - |
QNH40_RS02620 (QNH40_02620) | 543307..543672 | + | 366 | WP_019744212.1 | holo-ACP synthase | - |
QNH40_RS02625 (QNH40_02625) | 543833..544849 | + | 1017 | WP_007496489.1 | outer membrane lipoprotein-sorting protein | - |
QNH40_RS02630 (QNH40_02630) | 544978..546159 | + | 1182 | WP_283931232.1 | alanine racemase | - |
QNH40_RS02635 (QNH40_02635) | 546453..546734 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
QNH40_RS02640 (QNH40_02640) | 546739..547089 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNH40_RS02645 (QNH40_02645) | 547204..548034 | + | 831 | WP_007496484.1 | RsbT co-antagonist protein RsbRA | - |
QNH40_RS02650 (QNH40_02650) | 548039..548407 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
QNH40_RS02655 (QNH40_02655) | 548410..548811 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
QNH40_RS02660 (QNH40_02660) | 548822..549829 | + | 1008 | WP_008346904.1 | PP2C family protein-serine/threonine phosphatase | - |
QNH40_RS02665 (QNH40_02665) | 549889..550218 | + | 330 | WP_008346902.1 | anti-sigma factor antagonist | - |
QNH40_RS02670 (QNH40_02670) | 550215..550703 | + | 489 | WP_007496471.1 | anti-sigma B factor RsbW | - |
QNH40_RS02675 (QNH40_02675) | 550669..551457 | + | 789 | WP_025206796.1 | RNA polymerase sigma factor SigB | - |
QNH40_RS02680 (QNH40_02680) | 551457..552056 | + | 600 | WP_008346897.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T282594 WP_003214169.1 NZ_CP126086:546739-547089 [Bacillus altitudinis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K2MHT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A081L854 |