Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 4092553..4093188 | Replicon | chromosome |
| Accession | NZ_CP126084 | ||
| Organism | Paenibacillus woosongensis strain B2_4 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QNH46_RS18705 | Protein ID | WP_125082509.1 |
| Coordinates | 4092553..4092903 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | QNH46_RS18710 | Protein ID | WP_019638235.1 |
| Coordinates | 4092907..4093188 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH46_RS18690 (QNH46_18685) | 4088761..4089480 | - | 720 | WP_244996863.1 | hypothetical protein | - |
| QNH46_RS18695 (QNH46_18690) | 4089622..4091850 | - | 2229 | WP_283925572.1 | Tex family protein | - |
| QNH46_RS18700 (QNH46_18695) | 4091985..4092347 | - | 363 | WP_283925573.1 | DUF4190 domain-containing protein | - |
| QNH46_RS18705 (QNH46_18700) | 4092553..4092903 | - | 351 | WP_125082509.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| QNH46_RS18710 (QNH46_18705) | 4092907..4093188 | - | 282 | WP_019638235.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
| QNH46_RS18715 (QNH46_18710) | 4093445..4094629 | - | 1185 | WP_283928495.1 | alanine racemase | - |
| QNH46_RS18720 (QNH46_18715) | 4094854..4095951 | - | 1098 | WP_283925574.1 | outer membrane lipoprotein carrier protein LolA | - |
| QNH46_RS18725 (QNH46_18720) | 4096065..4096250 | - | 186 | WP_283925575.1 | hypothetical protein | - |
| QNH46_RS18730 (QNH46_18725) | 4096312..4096518 | + | 207 | WP_283925576.1 | hypothetical protein | - |
| QNH46_RS18735 (QNH46_18730) | 4096540..4097307 | + | 768 | WP_283925577.1 | methyl-accepting chemotaxis protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12820.83 Da Isoelectric Point: 5.6195
>T282592 WP_125082509.1 NZ_CP126084:c4092903-4092553 [Paenibacillus woosongensis]
MIVKRGDVFFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIEAATHGFDRDSVILLEQI
RTIDKQRLTDKITHLDDETMKKVNDSLLISLGLIDF
MIVKRGDVFFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIEAATHGFDRDSVILLEQI
RTIDKQRLTDKITHLDDETMKKVNDSLLISLGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|