Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 512490..513126 | Replicon | chromosome |
Accession | NZ_CP126083 | ||
Organism | Bacillus subtilis strain C1_9 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | QNK02_RS02620 | Protein ID | WP_003156187.1 |
Coordinates | 512776..513126 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | QNK02_RS02615 | Protein ID | WP_003225183.1 |
Coordinates | 512490..512771 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QNK02_RS02595 (QNK02_02595) | 508850..509449 | - | 600 | WP_041850724.1 | rhomboid family intramembrane serine protease | - |
QNK02_RS02600 (QNK02_02600) | 509544..509909 | + | 366 | WP_015252768.1 | holo-ACP synthase | - |
QNK02_RS02605 (QNK02_02605) | 510075..511091 | + | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
QNK02_RS02610 (QNK02_02610) | 511205..512374 | + | 1170 | WP_015252766.1 | alanine racemase | - |
QNK02_RS02615 (QNK02_02615) | 512490..512771 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
QNK02_RS02620 (QNK02_02620) | 512776..513126 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
QNK02_RS02625 (QNK02_02625) | 513241..514065 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
QNK02_RS02630 (QNK02_02630) | 514070..514435 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
QNK02_RS02635 (QNK02_02635) | 514439..514840 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
QNK02_RS02640 (QNK02_02640) | 514852..515859 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
QNK02_RS02645 (QNK02_02645) | 515921..516250 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
QNK02_RS02650 (QNK02_02650) | 516247..516729 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
QNK02_RS02655 (QNK02_02655) | 516695..517483 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
QNK02_RS02660 (QNK02_02660) | 517483..518082 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T282590 WP_003156187.1 NZ_CP126083:512776-513126 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|