Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1316948..1317864 | Replicon | chromosome |
| Accession | NZ_CP126082 | ||
| Organism | Bacillus subtilis strain C1_13 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | QNH30_RS06910 | Protein ID | WP_003244695.1 |
| Coordinates | 1317118..1317864 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | QNH30_RS06905 | Protein ID | WP_003232646.1 |
| Coordinates | 1316948..1317118 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QNH30_RS06870 (QNH30_06870) | 1313811..1314140 | + | 330 | WP_041850928.1 | XkdW family protein | - |
| QNH30_RS06875 (QNH30_06875) | 1314137..1314301 | + | 165 | WP_041850927.1 | XkdX family protein | - |
| QNH30_RS06880 (QNH30_06880) | 1314345..1315184 | + | 840 | WP_041850926.1 | phage-like element PBSX protein XepA | - |
| QNH30_RS06885 (QNH30_06885) | 1315237..1315506 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| QNH30_RS06890 (QNH30_06890) | 1315519..1315782 | + | 264 | WP_003232653.1 | phage holin | - |
| QNH30_RS06895 (QNH30_06895) | 1315795..1316688 | + | 894 | WP_041850925.1 | N-acetylmuramoyl-L-alanine amidase | - |
| QNH30_RS06900 (QNH30_06900) | 1316725..1316862 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| QNH30_RS06905 (QNH30_06905) | 1316948..1317118 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| QNH30_RS06910 (QNH30_06910) | 1317118..1317864 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| QNH30_RS06915 (QNH30_06915) | 1317974..1318975 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| QNH30_RS06920 (QNH30_06920) | 1318988..1319605 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| QNH30_RS06925 (QNH30_06925) | 1319881..1321197 | - | 1317 | WP_041850924.1 | serine/threonine exchanger | - |
| QNH30_RS06930 (QNH30_06930) | 1321585..1322535 | + | 951 | WP_041344800.1 | ring-cleaving dioxygenase | - |
| QNH30_RS06935 (QNH30_06935) | 1322636..1322782 | + | 147 | WP_120363335.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1283075..1325941 | 42866 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T282589 WP_003244695.1 NZ_CP126082:c1317864-1317118 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|